Dataset for protein Bcl-xL of organism Oryzias latipes

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3ICL7_BCL2L1-      MTKWKKS---WHLTYKMSCRDYPVSLL------KPTDDGGETEEDHSDAR
A0A3B3ICL7_BCL2L1-      MSHCNRELVRFYLAYKMSCRDYPVSLL------KPTDDGGETEEDHSDAR
A0A3B3IB64_BCL2L1-      -MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETH
A0A3P9JYH1_BCL2L1-      -MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETH
                            :..   ::: **:* *:**:. :      : *  *   **: :::.

A0A3B3ICL7_BCL2L1-      NRRLVSSEDGRL-------RRSCPCCASMDAIKSTLKDSADEFERRFHQG
A0A3B3ICL7_BCL2L1-      NRRLVSSEDGRL-------RRSCPCCASMDAIKSTLKDSADEFERRFHQG
A0A3B3IB64_BCL2L1-      ANGTFNGTTPGTPPLSPLREQQLPSTTNMDAVKEALRDTANEFELRYALA
A0A3P9JYH1_BCL2L1-      ANGTFNGTTPGTPPLSPLREQQLPSTTNMDAVKEALRDTANEFELRYALA
                         .  ...             .. *. :.***:*.:*.*:*:*** *:  .

A0A3B3ICL7_BCL2L1-      FSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVEC
A0A3B3ICL7_BCL2L1-      FSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVEC
A0A3B3IB64_BCL2L1-      FNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVEC
A0A3P9JYH1_BCL2L1-      FNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVEC
                        *.:*  ****** ****.*:.*::***.*.*****:****.*********

A0A3B3ICL7_BCL2L1-      VERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDCFARLYGQNGAAEAR
A0A3B3ICL7_BCL2L1-      VERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDCFARLYGQNGAAEAR
A0A3B3IB64_BCL2L1-      VEKEMSPLVDRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESR
A0A3P9JYH1_BCL2L1-      VEKEMSPLVDRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESR
                        **.:*. **.**.**** ***::*.***:*:***: ** ::**:.***:*

A0A3B3ICL7_BCL2L1-      RFQETLKKWMLVTVALLTGLLLGVLITKKR-
A0A3B3ICL7_BCL2L1-      RFQETLKKWMLVTVALLTGLLLGVLITKKR-
A0A3B3IB64_BCL2L1-      RSQESFKKWLLVGMTVATGVLVGSFLAQKRL
A0A3P9JYH1_BCL2L1-      RSQESFKKWLLVGMTVATGVLVGSFLAQKRL
                        * **::***:** ::: **:*:* ::::** 

© 1998-2019