Dataset for protein Mcl-1 of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1T2Q0_MCL1-02      MFSLRRNAVIGLNLYLGGPGLGAGGGGVAPPAERLLAAEKEAAARLEVGGGEAGAVIGGS
G1T2Q0_MCL1-01      MFSLRRNAVIGLNLYLGGPGLGAGGGGVAPPAERLLAAEKEAAARLEVGGGEAGAVIGGS
                    ************************************************************

G1T2Q0_MCL1-02      PGASPPAALAPDARRVARPAPIGAELPDVSATPARLLYLAPTRRASPLEEMEAPAADAIM
G1T2Q0_MCL1-01      PGA------------------IGAELPDVSATPARLLYLAPTRRASPLEEMEAPAADAIM
                    ***                  ***************************************

G1T2Q0_MCL1-02      SPEEELDGYEPEPLAKRPAVLPLLDLVGEASKVPSTDGSLPSTPPPAEEEEDELYRQSLE
G1T2Q0_MCL1-01      SPEEELDGYEPEPLAKRPAVLPLLDLVGEASKVPSTDGSLPSTPPPAEEEEDELYRQSLE
                    ************************************************************

G1T2Q0_MCL1-02      IIARYLREQATGAKDAKPMGRAGSASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
G1T2Q0_MCL1-01      IIARYLREQATGAKDAKPMGRAGSASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
                    ************************************************************

G1T2Q0_MCL1-02      DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
G1T2Q0_MCL1-01      DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                    ************************************************************

G1T2Q0_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLESGIRNVLLAFAGVAGVGAGLAYLIR
G1T2Q0_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLESGIRNVLLAFAGVAGVGAGLAYLIR
                    **************************************************

© 1998-2019