Dataset for protein BCL-2-like of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1T2Q0_MCL1-02         MFSLRRNAVIGLNLYLGGPGLGAGGGGVAPPAERLLAAEKEAAARLEVGG
G1T2Q0_MCL1-01         MFSLRRNAVIGLNLYLGGPGLGAGGGGVAPPAERLLAAEKEAAARLEVGG
G1T1L8_BCL2A1-01       MFASQGFGSFQKKQSPALLSEQQKMSDCEFGYVHTLAQD-----------
G1T264_BCL2L10-01      -----------------RPQRRLAMADALEERTARLLTD-----------
G1TV33_BCL2L2-01       LSLCLHIPDIHAGLSSLPLTAARMATPASAPDTRALVAD-----------
G1TW27_BCL2-01         ----------------------MAHAGRTGYDNREIVMK-----------
Q9MYW4_BCL2L1-01       ----------------------------MSQSNRELVVD-----------
                                                          :  .           

G1T2Q0_MCL1-02         GEAGAVIGGSPGASPPAALAPDARRVARPAPIGAELPDVSATPARLLYLA
G1T2Q0_MCL1-01         GEAGAVIGGSPGA------------------IGAELPDVSATPARLLYLA
G1T1L8_BCL2A1-01       --------------------------------------------YLLYIL
G1T264_BCL2L10-01      --------------------------------------------YLECCA
G1TV33_BCL2L2-01       --------------------------------------------FVGYKL
G1TW27_BCL2-01         --------------------------------------------YIHYKL
Q9MYW4_BCL2L1-01       --------------------------------------------FLSYKL
                                                                    :    

G1T2Q0_MCL1-02         PTRRASPLEEMEAPAADAIMSPEEELDGYEPEPLAKRPAVLPLLDLVGEA
G1T2Q0_MCL1-01         PTRRASPLEEMEAPAADAIMSPEEELDGYEPEPLAKRPAVLPLLDLVGEA
G1T1L8_BCL2A1-01       KTPQ----------------------------------------------
G1T264_BCL2L10-01      REPG----------------------------------------------
G1TV33_BCL2L2-01       RQKGYVCG------------------------------------------
G1TW27_BCL2-01         SQRGYEWD-------------AGDAGAASAPGVFSSQPAPAAPRDPAART
Q9MYW4_BCL2L1-01       SQKGYSWSQFSDVEENRTEAPEGTGPEMETPSAINGNPAWHPADSPAVNG
                                                                         

G1T2Q0_MCL1-02         SKVPSTDGSLPSTPPPAEEEEDELYRQSLEIIARYLREQATGAKDAKPMG
G1T2Q0_MCL1-01         SKVPSTDGSLPSTPPPAEEEEDELYRQSLEIIARYLREQATGAKDAKPMG
G1T1L8_BCL2A1-01       --------PGLGPSK-----------------------------------
G1T264_BCL2L10-01      ---------TPEPQP-----------------------------------
G1TV33_BCL2L2-01       --------AGPGEGP-----------------------------------
G1TW27_BCL2-01         SPPPPPAAAGPALSP-----------------------------------
Q9MYW4_BCL2L1-01       ATGHSSSLDAREVIP-----------------------------------
                                                                         

G1T2Q0_MCL1-02         RAGSASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
G1T2Q0_MCL1-01         RAGSASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
G1T1L8_BCL2A1-01       ----TSRVLQNVTFSIQQEVEEALQPYLHNVPVA---SVETARTIFNQVM
G1T264_BCL2L10-01      ----STPEAA-VLRCAATQLQRVHWPFFSVYRG----YPGNRIELAARVA
G1TV33_BCL2L2-01       ----AANPLHQAMRAAGDEFETRFRQNFSDLAAQLHVTPGSAQQSFTQVC
G1TW27_BCL2-01         ----VPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFHARGRFATVV
Q9MYW4_BCL2L1-01       ----MTAVKQ-ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVV
                            .     .       ..      :                    * 

G1T2Q0_MCL1-02         VHVFSDGV-TNWGRIVTLISFGAFV--------AKHLKSINQESCIE---
G1T2Q0_MCL1-01         VHVFSDGV-TNWGRIVTLISFGAFV--------AKHLKSINQESCIE---
G1T1L8_BCL2A1-01       EKEFEDGV-INWGRIVTIFAFEGVL--------AKKLLQEQAVPDVDTFK
G1T264_BCL2L10-01      EAVLSDGHDLSWGRVVTLVTFAGTLLDRGPPVTTQRVRRNEIARDCQ---
G1TV33_BCL2L2-01       DELFQRG--PNWGRVVAFFAFGAAL--------CAESVNKEMEPLVG---
G1TW27_BCL2-01         EELFRDG--VNWGRIVAFFEFGGVM--------CVESVNREMSPLVD---
Q9MYW4_BCL2L1-01       NELFRDG--VNWGRIVAFFSFGGAL--------CVESVDKEMEVLVS---
                          :  *   .***:*::. * . :               :         

G1T2Q0_MCL1-02         PLAESITDVLVRTKRDWLVKQRGWD-GFVEFFHVED----------LESG
G1T2Q0_MCL1-01         PLAESITDVLVRTKRDWLVKQRGWD-GFVEFFHVED----------LESG
G1T1L8_BCL2A1-01       SIPYFVAEFITRRMGEWIRQNGGWENGFVKKFEHNS-------------G
G1T264_BCL2L10-01      RLVALLCARLAGQHRAWLQAQGGWD-GFCVFYRTPL----------PLTF
G1TV33_BCL2L2-01       QVQEWMVTYLETQLAGWIHSTGGWA-EFTALYGDRALEEARRLREGTWAS
G1TW27_BCL2-01         NIALWMTEYLNRHLHTWIQDNGGWD-AFVELYGPSVRPLSDF----SWVS
Q9MYW4_BCL2L1-01       RIAAWMATYLNDHLEPWIQENGGWD-TFVELYGNNAAAESRK----GQER
                        :   :   :      *:    **   *   :                  

G1T2Q0_MCL1-02         IRNVLLAFAGVAGVGAGLAYLIR----
G1T2Q0_MCL1-01         IRNVLLAFAGVAGVGAGLAYLIR----
G1T1L8_BCL2A1-01       WKIFLEVAKQICVILSLLKKYC-----
G1T264_BCL2L10-01      WRRLLVRTF-LSCFVATALLFAWTRVY
G1TV33_BCL2L2-01       VRTVLTGAVALGALVTVGAFFASK---
G1TW27_BCL2-01         LKTLFSLAL-IGACITLGAYLGHK---
Q9MYW4_BCL2L1-01       FNRWFLTGMTVAGVVLLGSLFSRK---
                        .  :     :                

© 1998-2019