Dataset for protein BCL-2-like of organism Ornithorhynchus anatinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6S8G3_BCL2A1-01      --------------------------------------------------
F7G6M3_BCL2L2-01      MPSARNSPLPRQSAAPQPCCLAPCPSRPPGSPPDAPPRPPPPRCPAAPRM
                                                                        

F6S8G3_BCL2A1-01      --MDDGVFWSVRALALDYLDDVLQTPRL----GTVPSRTSRALQNVMFSV
F7G6M3_BCL2L2-01      ATPAPASVSDTRALVADFVGYKLRQKGFACGAGPGEGPPAQPLHRAMRAA
                           . . ..***. *::.  *.   :    *.  . .:..*:..* :.

F6S8G3_BCL2A1-01      QGDVEKALKPCFDSLDVG---SVGAARRIFGQIVEKEFEDGIVNWGRIVT
F7G6M3_BCL2L2-01      GDEFESRFRRAFSDLASQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVA
                       .:.*. :. .*..*      : *:*.. * *: :: *:.*  ****:*:

F6S8G3_BCL2A1-01      IFVLGGIL-TKKLQRSGVPLTRETREEISCFIAEFTTHHAGEWIRQNGGW
F7G6M3_BCL2L2-01      FFVFGAALCAESVNKEMEPLVGQVQD----WMVAYLDTQLADWIRSSGGW
                      :**:*. * ::.::..  **. :..:    ::. :   : .:***..***

F6S8G3_BCL2A1-01      ENGFLNKFEQKTV----------WSVLADI--SMKILGVLSHLKQFY---
F7G6M3_BCL2L2-01      AE-FTALYGDGALEDARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
                       : *   : : ::          *: :  :  .   **.*  :  *:   

© 1998-2019