Dataset for protein Mcl-1 of organism Oreochromis niloticus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3JHR5_MCL1-01      MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKR
I3KXG5_MCL1-01      ------------------------------------------------------------
                                                                                

I3JHR5_MCL1-01      PNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGESDEELERETKLLIHSFLGDFTGL
I3KXG5_MCL1-01      -----------------------------------------LERETKLIIHSFLGDFTGL
                                                             *******:***********

I3JHR5_MCL1-01      SQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDERHEDMSFVGAVAKSLFADHT
I3KXG5_MCL1-01      SQPQRKETKALKMMKRVVADVLEKHRYAYNGMINKLSLDEREEDMSF---VAKSLFGDHT
                    ************ **************************** *****   ******.***

I3JHR5_MCL1-01      TNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
I3KXG5_MCL1-01      TNWGRIVSFVAFGAVVSQHLKEKGRDNCVVLVSQEISAYLLSEQRDWIIKNNAWDGFVAF
                    *****************************.*****:************:********* *

I3JHR5_MCL1-01      FRVADPESTVRNTLMAFAGFAGIGATLALLIRFWDALL
I3KXG5_MCL1-01      VRVADPESIVRNTLMAFAGFACIGATLALLIR------
                    .******* ************ **********      

© 1998-2019