Dataset for protein BCL-2-like of organism Oreochromis niloticus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3KXG5_MCL1-01         --------------------------------------------------
I3JHR5_MCL1-01         MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSN
I3IZK7_BCL2L1-01       ---------------------------------------YKMSQNRELVL
I3J363_BCL2L10-01      --------------------------------MSRGGVTHSLSAEGKTQL
                                                                         

I3KXG5_MCL1-01         --------------------------------------------------
I3JHR5_MCL1-01         GIVSNGTPKRPNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGESDE
I3IZK7_BCL2L1-01       FYIRYKLSQRNYPLNHIVLNEPLNRTDGGA--AG----------------
I3J363_BCL2L10-01      Y--------RRSPSAVCMCREQSDIAGRKMKFCG----------------
                                                                         

I3KXG5_MCL1-01         -LERETKLIIH---SFLGDFTGLSQPQRKETK----------ALKMMKRV
I3JHR5_MCL1-01         ELERETKLLIH---SFLGDFTGLSQPQRKETK----------ALKTMKRV
I3IZK7_BCL2L1-01       -LDEEQRIDTHANGTFNGTSPGTPPASPQRQQQPPSTTDLDAVKEALRDT
I3J363_BCL2L10-01      -LWKETLLLAEDYLSFCCTSPHQAPPPPSESA------------AAMRRL
                        *  *  :      :*    .  . .  .                 :.  

I3KXG5_MCL1-01         VADVLEKHRYAYNGMINKLSLDEREEDMSF---VAKSLFGDHTTNWGRIV
I3JHR5_MCL1-01         VADVLEKHRYAYNGMINKLSLDERHEDMSFVGAVAKSLFADHTTNWGRIV
I3IZK7_BCL2L1-01       ANEFELRYARAFSDLHSQLHITPATAY-QSFENVMDEVFRDG-VNWGRIV
I3J363_BCL2L10-01      GWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVV
                         :.  .:   :..: . : :            * ..:. *   ****:*

I3KXG5_MCL1-01         SFVAFGAVVSQHLKEKGRDNCVV-------------LVSQEISAYLLSEQ
I3JHR5_MCL1-01         SFVAFGAVVSQHLKEKGRDNCVA-------------LVSQEVSAYLLSEQ
I3IZK7_BCL2L1-01       GLFAFGGALCVECVEKEMSPLVG-------------RIVEWMTVYLDNHI
I3J363_BCL2L10-01      SLFAFTGVLARKILEQKPGLDPGQQQELGQEPMSCRRLAETIADYLGEEK
                       .:.** ..:.    *:  .                  : : :: ** .  

I3KXG5_MCL1-01         RDWIIKNNAWDGFVAFV------RVADPESIVRNTLMAFAGFACIGATLA
I3JHR5_MCL1-01         RDWIVKNNAWDGFVEFF------RVADPESTVRNTLMAFAGFAGIGATLA
I3IZK7_BCL2L1-01       QPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGA
I3J363_BCL2L10-01      KDWLLDNDGWEGFCKF---SRSAREVSQDSSMKKALFAAAGVGLAGLTFL
                       . *: .:..*: *  :            :. ..: *:.   .     :  

I3KXG5_MCL1-01         LLIR------
I3JHR5_MCL1-01         LLIRFWDALL
I3IZK7_BCL2L1-01       LIAQK---RL
I3J363_BCL2L10-01      LVKGF---RF
                       *:        

© 1998-2019