Dataset for protein Mcl-1 of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3GB35_MCL1-03      MFGLRRNAVIGLNLYCGGAGLGAGSG------------------------
A0A2I3GB35_MCL1-01      MFGLRRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2I3GB35_MCL1-02      MFGLRRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
                        **************************                        

A0A2I3GB35_MCL1-03      --------------------------------------------------
A0A2I3GB35_MCL1-01      GEAGAVIGGSAGASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFA
A0A2I3GB35_MCL1-02      GEAGAVIGGSAGASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFFA
                                                                          

A0A2I3GB35_MCL1-03      --------------------------------------------------
A0A2I3GB35_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2I3GB35_MCL1-02      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
                                                                          

A0A2I3GB35_MCL1-03      --------------------------------------------------
A0A2I3GB35_MCL1-01      GNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2I3GB35_MCL1-02      GNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
                                                                          

A0A2I3GB35_MCL1-03      -----------------------------GMLRKLDIKNEDDVKSLSRVM
A0A2I3GB35_MCL1-01      RSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV---------------
A0A2I3GB35_MCL1-02      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                                                     * :  :               

A0A2I3GB35_MCL1-03      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
A0A2I3GB35_MCL1-01      --LPCRGPRRW---------------------HQKCAAGFCRCCWS----
A0A2I3GB35_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
                          : . *  .*                     ::.*   :. .  .    

A0A2I3GB35_MCL1-03      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2I3GB35_MCL1-01      --RSWF---------------------------------GISNKIALL--
A0A2I3GB35_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                          *.*:                                 *:.  :* *  

© 1998-2019