Dataset for protein BCL-2-like of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3GB35_MCL1-01      MFGLRRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2I3GB35_MCL1-02      MFGLRRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
G1RYB4_BCL2L2-03        -----------------------MATPASAPDTRALVADFVGYKLR----
G1RYB4_BCL2L2-01        -----------------------MATPASAPDTRALVADFVGYKLR----
A0A2I3GZF9_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLS----
G1R3W6_BCL2L10-01       ------------------------MVDQLRERTERLLADYL---------
A0A2I3GB35_MCL1-03      ----------------------------MFGLRRNAVIGLNLYC------
G1RER8_BCL2L1-01        ------------------------MSQSN----RELVVDFLSYKLS----
A0A2I3HNF3_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQYVL-----
A0A2I3HNF3_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQYVL-----
A0A2I3HNF3_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQYVL-----
                                                                          

A0A2I3GB35_MCL1-01      GEAGAVIGGSAGASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFF-
A0A2I3GB35_MCL1-02      GEAGAVIGGSAGASPPSVLTPDSRRVARPPPIGAEVSDVTATPARLLFF-
G1RYB4_BCL2L2-03        -QKGYVCGAGPG--------------------------------------
G1RYB4_BCL2L2-01        -QKGYVCGAGPG--------------------------------------
A0A2I3GZF9_BCL2-01      -QRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLP
G1R3W6_BCL2L10-01       -----------------------GCCAREPG---------------TPEP
A0A2I3GB35_MCL1-03      ---------------------------GGAGLGA----------------
G1RER8_BCL2L1-01        -QKGYSWSQFSDVEENRTEAPE-GTESEMETPSAINGNPSWHLADSPAVN
A0A2I3HNF3_BCL2A1-      ---------------------------QIPQPGS----------------
A0A2I3HNF3_BCL2A1-      ---------------------------QIPQPGS----------------
A0A2I3HNF3_BCL2A1-      ---------------------------QIPQPGS----------------
                                                                          

A0A2I3GB35_MCL1-01      APTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGE
A0A2I3GB35_MCL1-02      APTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGE
G1RYB4_BCL2L2-03        ------------EGPAADPL------------------------------
G1RYB4_BCL2L2-01        ------------EGPAADPL------------------------------
A0A2I3GZF9_BCL2-01      TPAAPGAAAGPALSPVPPVV------------------------------
G1R3W6_BCL2L10-01       TPSTPEAAMLRSAAA-----------------------------------
A0A2I3GB35_MCL1-03      GSGGMLRKLD----------------------------------------
G1RER8_BCL2L1-01        GATGHSSSLDAREVIPMAAV------------------------------
A0A2I3HNF3_BCL2A1-      GPSKTSRVLQNVAFSVQKEV------------------------------
A0A2I3HNF3_BCL2A1-      GPSKTSRVLQNVAFSVQKEV------------------------------
A0A2I3HNF3_BCL2A1-      GPSKTSRVLQNVAFSVQKEV------------------------------
                                                                          

A0A2I3GB35_MCL1-01      SGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPM
A0A2I3GB35_MCL1-02      SGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPM
G1RYB4_BCL2L2-03        --------------------------------------------------
G1RYB4_BCL2L2-01        --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2I3GB35_MCL1-01      GRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV--------------
A0A2I3GB35_MCL1-02      GRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
G1RYB4_BCL2L2-03        ----------HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
G1RYB4_BCL2L2-01        ----------HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A2I3GZF9_BCL2-01      ----------HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATV
G1R3W6_BCL2L10-01       ------------RLRQLHPSFFSAY---LGYPGNRVELVVLMADSVLSD-
A0A2I3GB35_MCL1-03      -------------------------------------IKNEDDVKSLSRV
G1RER8_BCL2L1-01        ----------KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV
A0A2I3HNF3_BCL2A1-      ----------EKNLKPCLDNVNV--------------VSIDTARTLFNQV
A0A2I3HNF3_BCL2A1-      ----------EKNLKPCLDNVNV--------------VSIDTARTLFNQV
A0A2I3HNF3_BCL2A1-      ----------EKNLKPCLDNVNV--------------VSIDTARTLFNQV
                                                                          

A0A2I3GB35_MCL1-01      ---LPCRGPRRW--------------------------------------
A0A2I3GB35_MCL1-02      MVHVFSDGVTNWGRIVTLISFGAFVA------------------KHLKTI
G1RYB4_BCL2L2-03        SDELFQGGP-NWGRLVAFFVFGAALC------------------AESVNK
G1RYB4_BCL2L2-01        SDELFQGGP-NWGRLVAFFVFGAALC------------------AESVNK
A0A2I3GZF9_BCL2-01      VEELFRDG-VNWGRIVAFFEFGGVMC------------------VESVNR
G1R3W6_BCL2L10-01       -----SPG-PTWGRVVTLVAFAGTLLERGPLVTARWKKWGFQPRLKEQEG
A0A2I3GB35_MCL1-03      MVHVFSDGVTNWGRIVTLISFGAFVA------------------KHLKTI
G1RER8_BCL2L1-01        VNELFRDG-VNWGRIVAFFSFGGALC------------------VESVDK
A0A2I3HNF3_BCL2A1-      MEKEFEDGIINWGRIVTIFAFEGILV------------------KKLLRQ
A0A2I3HNF3_BCL2A1-      MEKEFEDGIINWGRIVTIFAFEGILV------------------KKLLRQ
A0A2I3HNF3_BCL2A1-      MEKEFEDGIINWGRIVTIFAFEGILV------------------KKLLRQ
                               *   *                                      

A0A2I3GB35_MCL1-01      -HQKCAA---GFCRCCWS------RSWF----------------------
A0A2I3GB35_MCL1-02      NQESCIE---PLAESITDVLVRTKRDWLVKQRGWDG--------------
G1RYB4_BCL2L2-03        EMEPLVG---QVQEWMVAYLETRLADWIHSSGGWA---------------
G1RYB4_BCL2L2-01        EMEPLVG---QVQEWMVAYLETRLADWIHSSGGWEL--------------
A0A2I3GZF9_BCL2-01      EMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWDA--------------
G1R3W6_BCL2L10-01       DVARDCQ---RLVALLSSRLVGQHRAWLQAQGGWVSTRRTPGHGAGRAAG
A0A2I3GB35_MCL1-03      NQESCIE---PLAESITDVLVRTKRDWLVKQRGWDG--------------
G1RER8_BCL2L1-01        EMQVLVS---RIAAWMATYLNDHLEPWIQENGGWDT--------------
A0A2I3HNF3_BCL2A1-      RTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK--------------
A0A2I3HNF3_BCL2A1-      RTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN---------GFVKK
A0A2I3HNF3_BCL2A1-      RTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN---------GFVKK
                                   .              *:                      

A0A2I3GB35_MCL1-01      --------------------------------------------------
A0A2I3GB35_MCL1-02      ------FVEFFHVEDLEGGIRNV---------------------------
G1RYB4_BCL2L2-03        ------EFTALYGDGALEEARRLRE---------------GNWASV----
G1RYB4_BCL2L2-01        ------EAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A2I3GZF9_BCL2-01      ---------FVELY----GPSMR---------------------------
G1R3W6_BCL2L10-01       KRPRGRHGWLLSLL----QDPLS---------------------------
A0A2I3GB35_MCL1-03      ------FVEFFHVEDLEGGIRNV---------------------------
G1RER8_BCL2L1-01        ---------FVELY----GNNAA---------------------------
A0A2I3HNF3_BCL2A1-      ------WHNHMPM-------LVE---------------------------
A0A2I3HNF3_BCL2A1-      FEPKSGWMTFLEVT----GKICE---------------------------
A0A2I3HNF3_BCL2A1-      FEPKSGWMTFLEVT----GKISI---------------------------
                                                                          

A0A2I3GB35_MCL1-01      ----------------GISNKIALL-------------------------
A0A2I3GB35_MCL1-02      --------LLAFAGVAGVGAGLAYLIR-----------------------
G1RYB4_BCL2L2-03        --------RTVLTGAVALGALVT---------------------------
G1RYB4_BCL2L2-01        EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A2I3GZF9_BCL2-01      --------PLF-------DFSWLSLKTLLSLALVGACITLGAYLGHK---
G1R3W6_BCL2L10-01       --------AGFLEKTAGPGFSVMLVNNSLHLFLDTIIMSFKTFNPLLPAQ
A0A2I3GB35_MCL1-03      --------LLAFAGVAGVGAGLAYLIR-----------------------
G1RER8_BCL2L1-01        --------AESRKGQERFNRWFLTG-------------------------
A0A2I3HNF3_BCL2A1-      --------SVAHKKRKMAL-------------------------------
A0A2I3HNF3_BCL2A1-      --------MLSFLKQ-YC--------------------------------
A0A2I3HNF3_BCL2A1-      --------LLTRKDTPYCETGLIFLTLMETIANTYFYFKINNFDDVT---
                                                                          

A0A2I3GB35_MCL1-01      --------------------------------------------------
A0A2I3GB35_MCL1-02      --------------------------------------------------
G1RYB4_BCL2L2-03        --------------------------------------------------
G1RYB4_BCL2L2-01        GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
A0A2I3GZF9_BCL2-01      --------------------------------------------------
G1R3W6_BCL2L10-01       L-------------------------------------------------
A0A2I3GB35_MCL1-03      --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
A0A2I3HNF3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2I3GB35_MCL1-01      -------------------------------------------
A0A2I3GB35_MCL1-02      -------------------------------------------
G1RYB4_BCL2L2-03        -----------------------------------VGAFFASK
G1RYB4_BCL2L2-01        ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2I3GZF9_BCL2-01      -------------------------------------------
G1R3W6_BCL2L10-01       -------------------------------------------
A0A2I3GB35_MCL1-03      -------------------------------------------
G1RER8_BCL2L1-01        -------------------------------------------
A0A2I3HNF3_BCL2A1-      -------------------------------------------
A0A2I3HNF3_BCL2A1-      -------------------------------------------
A0A2I3HNF3_BCL2A1-      -------------------------------------------
                                                                   

© 1998-2019