Dataset for protein Bcl-w of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1RYB4_BCL2L2-03      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
G1RYB4_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                      **************************************************

G1RYB4_BCL2L2-03      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
G1RYB4_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                      **************************************************

G1RYB4_BCL2L2-03      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFTA
G1RYB4_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIK
                      ********************************************  *   

G1RYB4_BCL2L2-03      LYGDGALEEARRLRE---------------GNWASV------------RT
G1RYB4_BCL2L2-01      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
                             *** .*.*               ** ..*            *:

G1RYB4_BCL2L2-03      VLTGAVALGALVT-------------------------------------
G1RYB4_BCL2L2-01      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
                      : .* *  ** .                                      

G1RYB4_BCL2L2-03      --------------------------------------------------
G1RYB4_BCL2L2-01      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
                                                                        

G1RYB4_BCL2L2-03      -------------------------VGAFFASK
G1RYB4_BCL2L2-01      NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                                               . ::::. 

© 1998-2019