Dataset for protein Bfl1 of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3HNF3_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
A0A2I3HNF3_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
A0A2I3HNF3_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
                        **************************************************

A0A2I3HNF3_BCL2A1-      NLKPCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILV
A0A2I3HNF3_BCL2A1-      NLKPCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILV
A0A2I3HNF3_BCL2A1-      NLKPCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILV
                        **************************************************

A0A2I3HNF3_BCL2A1-      KKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK--------
A0A2I3HNF3_BCL2A1-      KKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
A0A2I3HNF3_BCL2A1-      KKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
                        **************************************** :        

A0A2I3HNF3_BCL2A1-      ---WHNHMPM---LVESVAHKKRKMAL-----------------------
A0A2I3HNF3_BCL2A1-      KSGWMTFLEVTGKICEMLSFLKQ-YC------------------------
A0A2I3HNF3_BCL2A1-      KSGWMTFLEVTGKISILLTRKDTPYCETGLIFLTLMETIANTYFYFKINN
                           * ..: :   :   ::  .   .                        

A0A2I3HNF3_BCL2A1-      -----
A0A2I3HNF3_BCL2A1-      -----
A0A2I3HNF3_BCL2A1-      FDDVT
                             

© 1998-2019