Dataset for protein BCL-2-like of organism Neolamprologus brichardi

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q4HLQ8_MCL1-01      --------MTNYMMSKRNQCTFIDYLIPQNGVLEGPMHYGSGNSSPQNAT
A0A3Q4MN81_BCL2L10      MCREQSDIAGRKMKF-------------------------CGLWKETLVL
A0A3Q4N4B5_BCL2L1-      -MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRID
                                    :                           .*  .     

A0A3Q4HLQ8_MCL1-01      GSSKDSSNGIVSNGTPKRPDNLEVTSTNGYTTKAIRDREEDGSLPSTPEF
A0A3Q4MN81_BCL2L10      AEDYLSFCCTSPHQAPPPPSESA-------------A-------------
A0A3Q4N4B5_BCL2L1-      THANGTFNGTSPGTPPASPQRRQQQPPSTTDLDAVKE-------------
                             :     .  .*  *.                              

A0A3Q4HLQ8_MCL1-01      HSDSESDEQLERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVL
A0A3Q4MN81_BCL2L10      ----------------------------------------AMRRLGWDIE
A0A3Q4N4B5_BCL2L1-      ----------------------------------------ALRDTANEFE
                                                                ::.    :. 

A0A3Q4HLQ8_MCL1-01      EKHRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRVVSFVAF
A0A3Q4MN81_BCL2L10      RQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVVSLFAF
A0A3Q4N4B5_BCL2L1-      LRYARAFSDLHSQLHITPATAY-QSFENVMDEVFRDG-VNWGRIVGLFAF
                         .:   :..: . : :         .  * ..:. *   ****:*.:.**

A0A3Q4HLQ8_MCL1-01      GAVVSQHLKEKGRDNCVA-------------LVSQEISAYLLSEQRDWIV
A0A3Q4MN81_BCL2L10      TGVLARKILEQKPGLDPGQQQELGQEPMSCRRLAETIADYLGEEKKDWLL
A0A3Q4N4B5_BCL2L1-      GGALCVECVEKEMSPLVG-------------RIVEWMTVYLDNHIQPWIQ
                         ..:.    *:  .   .              : : :: ** .  . *: 

A0A3Q4HLQ8_MCL1-01      KNNAWDGFVEFF------RVADPESIVRHTLMAFAGFAGIGATLALLIR-
A0A3Q4MN81_BCL2L10      DNDGWEGFCKF---SRSAREVSQDSSMKKALFAAAG-VGLAGLTFLLVR-
A0A3Q4N4B5_BCL2L1-      SQGGWEHFAEIFGQDAAAESRRSQESFKKWLLVGMT-VVTGVVAGALIAQ
                        .:..*: * ::            :. ..: *:.    .  .     *:  

A0A3Q4HLQ8_MCL1-01      ---
A0A3Q4MN81_BCL2L10      ---
A0A3Q4N4B5_BCL2L1-      KRL
                           

© 1998-2019