Dataset for protein Mcl-1 of organism Myotis lucifugus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1PZ39_MCL1-01      ------------------------------------------------------------
G1QAV8_MCL1-01      MFGPKRNAFIGLNLHCGGAVGGLWRQRSLHLLQEGGPCPQESGAGRETGTVIGWSAGASP
                                                                                

G1PZ39_MCL1-01      -----------APPSPISGRGPRRHRDPSRGGCLRPLAVRGCPRRWKAAAADAIMSPEEE
G1QAV8_MCL1-01      QATLARDPGRVARPSPMGTEGPDGTAAPARW--LFSPISRNCPEELGALAADAIMSPGEE
                               * ***:.  **     *:*   * .   *.**    * ******** **

G1PZ39_MCL1-01      LDGYEPEPLGKRPAVLPLVQLVGEASGGPGAGGSLPSTPPPAEEEEDELFRQSLEIISRY
G1QAV8_MCL1-01      LGRYEPEP--KQPAVLPLLQLVGEASEGP-AGGSLPSTPPPAEEEEELSL---LEMIPQH
                    *. *****  *.******:******* ** ****************:  :   **:*..:

G1PZ39_MCL1-01      REQATGAKDAKPLGGPAASSRKALETLRRVGDGVQRNHEMAFQGERGPRALCLVRDRWAP
G1QAV8_MCL1-01      LRERAGARDQSQ--GPRVGGVQ-----RRAAGCSGVRQETAFLGML----------ELDT
                      : :**.* .   ** ... :     **...    .:* ** *               .

G1PZ39_MCL1-01      VGGNRDEPGLEGLSARFRN----------------QHILAMSH--CFRPPDSLGTALRSK
G1QAV8_MCL1-01      ENEDNVKSSSQAMVHAFRDGVTNGRIVTHFFWCLCSHLKSINQESCIEPLAEDITDVLVG
                     . :. :.. :.:   **:                .*: ::.:  *: *  .  * :   

G1PZ39_MCL1-01      AGKVWETSNTCHGFKDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
G1QAV8_MCL1-01      TERGWLVKQRGW---DGFVEFFQVEDLEGGVRNVLLAFAG-AGVGAGLPYLIR
                    : . * ..:  .   *******:*******:********* *******.****

© 1998-2019