Dataset for protein BCL-2-like of organism Myotis lucifugus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1QEX2_BCL2L10-01      --------------------------------------------------
G1P9D2_BCL2L1-01       --------------------------------------------------
G1P3J2_BCL2L2-01       --------------------------------------------------
G1Q051_BCL2L2-01       --------------------------------------------------
G1PZ39_MCL1-01         --------------------------------------------------
G1QAV8_MCL1-01         MFGPKRNAFIGLNLHCGGAVGGLWRQRSLHLLQEGGPCPQESGAGRETGT
                                                                         

G1QEX2_BCL2L10-01      --------------------------------DELKLRTRRLLTEFLEHR
G1P9D2_BCL2L1-01       ----------------------------------MSQSNRELVVDFLSYK
G1P3J2_BCL2L2-01       ---PEMLHSVSLTKYTHASLLSLTFTAARMATPASAPDTRALVADFVGYK
G1Q051_BCL2L2-01       ---MNEFSLDNFMLYSFDSVDIRPKVLGPKSSQPQAPDTQALVADFVGYK
G1PZ39_MCL1-01         ---------------------APPSPISGRGPRRHRDPSRGGCL----RP
G1QAV8_MCL1-01         VIGWSAGASPQATLARDPGRVARPSPMGTEGPDGTAAPARW--L----FS
                                                              .          

G1QEX2_BCL2L10-01      TRRRGT--------------------------------------------
G1P9D2_BCL2L1-01       LSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLVDSPAVN
G1P3J2_BCL2L2-01       LRQKGY-----------------------------------------VCG
G1Q051_BCL2L2-01       LRQKGY-----------------------------------------VCG
G1PZ39_MCL1-01         LAVRGCPRRWKAAAADAIMSPEEELDGYEPEPLGKRPAVLPLVQLVGEAS
G1QAV8_MCL1-01         PISRNCPEELGALAADAIMSPGEELGRYEPEP--KQPAVLPLLQLVGEAS
                          ..                                             

G1QEX2_BCL2L10-01      --------APQQPSTPEATVMRSL--------------------------
G1P9D2_BCL2L1-01       GATGHSSSLDAREVIPMAAVKQAL--------------------------
G1P3J2_BCL2L2-01       AGPGEGPAAD--------PLHQAM--------------------------
G1Q051_BCL2L2-01       AGPGEGPAAD--------PLHQAM--------------------------
G1PZ39_MCL1-01         GGPGAGGSLPSTPPPAEEEEDELFRQSLEIISRYREQATGAKDAKPLGGP
G1QAV8_MCL1-01         EGP-AGGSLPSTPPPAEEEEELSL---LEMIPQHLRERAGARDQSQ--GP
                                              :                          

G1QEX2_BCL2L10-01      ---------------------AAHSWLGTPH---------SWSRRQRNRL
G1P9D2_BCL2L1-01       -----------REAGDEFELRYRRAFSDLTS---------QLHITPGTAY
G1P3J2_BCL2L2-01       -----------RAAGDEFETRFRRTFSDLAA---------QLHVTPGSAQ
G1Q051_BCL2L2-01       -----------RAAGDEFETHFRCTFSDLVA---------QLHVTPGSAQ
G1PZ39_MCL1-01         AASSRKALETLRRVGDGVQRNHEMAFQGERGPRALCLVRDRWAPVGGNRD
G1QAV8_MCL1-01         RVGGVQ-----RRAAGCSGVRQETAFLGML----------ELDTENEDNV
                                               :: .                      

G1QEX2_BCL2L10-01      EQMVDQIESLVPDGTDPNWLSVVALVSFAGALLERPPPGHSQARREWDAT
G1P9D2_BCL2L1-01       QSFEQVVNELFRDG--VNWGRIVAFFSFGGAL----------CVESVDKE
G1P3J2_BCL2L2-01       QRFTQVSDELFQGG--PNWGRLVAFFVFGAAL----------CAESVNKE
G1Q051_BCL2L2-01       QCFTQVSDELFQGG--PNWGYLVAFFVFGAAL----------CVESVNKE
G1PZ39_MCL1-01         EPGLEGLSARFRN------------------Q----------HILAMSH-
G1QAV8_MCL1-01         KSSSQAMVHAFRDG--VTNGRIVTHFFWCLCS----------HLKSINQE
                       :   :     . .                                  .  

G1QEX2_BCL2L10-01      VDQDCQRLVTFLCSWLTETHRTWMEAQGGW---DGFCHNFMPAPPP----
G1P9D2_BCL2L1-01       MQVLVSRIATWMATYLNDHLEPWIQENGGW---DTFVELYGNNAAAESRK
G1P3J2_BCL2L2-01       MEPLVGQVQEWMVAYLETRLADWIHSSGGW---AEFTALYGDGALEEARR
G1Q051_BCL2L2-01       MEPLVGQVQEWTVAYLEMRLADWIHSIGGW---AEFTALY----------
G1PZ39_MCL1-01         ---CFRPPDSLGTALRSKAGKVWETSNTCHGFKDGFVEFFHVEDLE----
G1QAV8_MCL1-01         --SCIEPLAEDITDVLVGTERGWLVKQRGW---DGFVEFFQVEDLE----
                                             *      .     *   :          

G1QEX2_BCL2L10-01      ---GDRLLAPLLR---ACLVLIILICLWIKIM
G1P9D2_BCL2L1-01       ---GQERFNRWFLTG-MTVAGVVLLGSLFSRK
G1P3J2_BCL2L2-01       LREGNWASVRTVLTGAVALGALVTVGAFFASK
G1Q051_BCL2L2-01       ---GNWASVRTVLTGALALRALLTVGAFFASM
G1PZ39_MCL1-01         ---GGIRNVLLAFAGVAGVGA----GLAYLIR
G1QAV8_MCL1-01         ---GGVRNVLLAFAG-AGVGA----GLPYLIR
                          *              :             

© 1998-2019