Dataset for protein Bcl-w of organism Myotis lucifugus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1P3J2_BCL2L2-01      PEMLHSVSLTKYTHASLLSLTFTAARMATPASAPDTRALVADFVGYKLRQ
G1Q051_BCL2L2-01      MNEFSLDNFMLYSFDSVDIRPKVLGPKSSQPQAPDTQALVADFVGYKLRQ
                       : :   .:  *:. *:   . . .  :: ..****.*************

G1P3J2_BCL2L2-01      KGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGS
G1Q051_BCL2L2-01      KGYVCGAGPGEGPAADPLHQAMRAAGDEFETHFRCTFSDLVAQLHVTPGS
                      *******************************.** *****.*********

G1P3J2_BCL2L2-01      AQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQE
G1Q051_BCL2L2-01      AQQCFTQVSDELFQGGPNWGYLVAFFVFGAALCVESVNKEMEPLVGQVQE
                      *** **************** ************.****************

G1P3J2_BCL2L2-01      WMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVL
G1Q051_BCL2L2-01      WTVAYLEMRLADWIHSIGGWAEFTALY-------------GNWASVRTVL
                      * ***** ******** **********             **********

G1P3J2_BCL2L2-01      TGAVALGALVTVGAFFASK
G1Q051_BCL2L2-01      TGALALRALLTVGAFFASM
                      ***:** **:******** 

© 1998-2019