Dataset for protein BCL-2-like of organism Mustela putorius furo

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M3XZZ5_MCL1-01         MFGLKRNAVIGLNLYCGGAGLGAGTGGASSSGGRLLASGKEATARREVGG
M3YVH4_BCL2A1-01       --------------------------------------------------
M3YYK3_BCL2-01         --------------------------------------------------
M3Y8D1_BCL2L10-01      ------------------------------------------------MG
M3Y5X5_BCL2L2-01       --------------------------------------------------
M3Z2H9_BCL2L1-01       --------------------------------------------------
                                                                         

M3XZZ5_MCL1-01         GEAGAVIGGSAGASTPATLAPDARRVARPSPIGAEGPNVTATPPRLLFFE
M3YVH4_BCL2A1-01       ---------------------------MTDSEFGYTLSLAQDYVRHVLQI
M3YYK3_BCL2-01         -------------------------MAHAGRTGYDNREIVMKYIHYKLSQ
M3Y8D1_BCL2L10-01      VAAPPWAEAQRDLENRVGSGSAGRGRAMADALRERTAQLLTDYLEYCARG
M3Y5X5_BCL2L2-01       KPEAPLLAFQPYIHASLSSLTLTAARMATPASAPDTRALVADFVGYKLRQ
M3Z2H9_BCL2L1-01       -------------------------------MSQSNRELVVDFLSYKLSQ
                                                             :           

M3XZZ5_MCL1-01         PTHRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
M3YVH4_BCL2A1-01       PQP------------------------------------------SPAAS
M3YYK3_BCL2-01         RGR---------------PVMKLVYLPTAPPPPPLSRHRRPQLTSPATAL
M3Y8D1_BCL2L10-01      PGT-----------------------------------------------
M3Y5X5_BCL2L2-01       KGY-----------------------------------------VCGAGP
M3Z2H9_BCL2L1-01       KGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGAT
                                                                         

M3XZZ5_MCL1-01         SSGPCTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLG
M3YVH4_BCL2A1-01       RVSRVLRDVASSVQGEVE--------------------------------
M3YYK3_BCL2-01         AAAAAAGPALSPVPPVVH--------------------------------
M3Y8D1_BCL2L10-01      -PARSPSTREAAVLRSVA--------------------------------
M3Y5X5_BCL2L2-01       GEGPAAD--------PLH--------------------------------
M3Z2H9_BCL2L1-01       GHSSSLDAREVIPMAAVK--------------------------------
                         .                                               

M3XZZ5_MCL1-01         GPGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
M3YVH4_BCL2A1-01       ----------QNLRPCLDSFDVG--------------SIDTARTIFNQVM
M3YYK3_BCL2-01         ----------LTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
M3Y8D1_BCL2L10-01      ----------AVVRQRHERFLSDYRG-----------YGGNRVELVAQLE
M3Y5X5_BCL2L2-01       ----------QAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVS
M3Z2H9_BCL2L1-01       ----------QALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVV
                                   :*   : .                         .  : 

M3XZZ5_MCL1-01         VHVF--SDGVTNWGRIVTLISFGAFVAKHLKSINQESC------------
M3YVH4_BCL2A1-01       EKEF--EDGIINWGRIVTVFAFEGILSKKLLRERISPD------------
M3YYK3_BCL2-01         EELF--RDG-VNWGRIVAFFEFGGVMCVESVNREMSPL------------
M3Y8D1_BCL2L10-01      REILAHPQA-LSWGRVVALVTFAGTLLERPPSGACSNLGPDPELELELGE
M3Y5X5_BCL2L2-01       DELF--QGG-PNWGRLVAFFVFGAALCAESVNKEMEPL------------
M3Z2H9_BCL2L1-01       NELF--RDG-VNWGRIVAFFSFGGALCVESVDKEMQAL------------
                          :    .  .***:*:.. * . :         .              

M3XZZ5_MCL1-01         --------IEPLAESITDVLVRTKRDWLVKQRGW-DGFVEFFHVEDLE--
M3YVH4_BCL2A1-01       ------VDASRVSYFVAEFITTNMREWIRQNGGWEDGFVKKFEPKS----
M3YYK3_BCL2-01         --------VDNIALWMTEYLNRHLHTWIQDNGGW-PAPAPHEGPAARP--
M3Y8D1_BCL2L10-01      WEASVRQDCRRLVDFLCGRLTGQHRAWLEAHGGW-DGFCLFFTPALLSWK
M3Y5X5_BCL2L2-01       --------VGQVQEWMVAYLETRLADWIHSSGGW-AEFTALYGDGALEEA
M3Z2H9_BCL2L1-01       --------VSRIATWMATYLNDHLEPWIQENGGW-DTFVELYGNNAAAES
                                  :   :   :      *:    **                

M3XZZ5_MCL1-01         -------GGIRNVLLAFAGVAGVGA----GLAYLIR------
M3YVH4_BCL2A1-01       -----------------GWLTFLEVIGKICEMFSLLKQYY--
M3YYK3_BCL2-01         ---------------------------IVDDSYWPKVFSLLA
M3Y8D1_BCL2L10-01      RLLVQ---------------ALLSCFTAVILIYFWKRLPFIG
M3Y5X5_BCL2L2-01       RRLRE--GNWASVRTVLTGAVALGALVTVGAFFASK------
M3Z2H9_BCL2L1-01       RKGQERFNRWFLTGMTVAGVVLLGSL------FSRK------
                                                       :         

© 1998-2019