Dataset for protein Mcl-1 of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P97287_MCL1-02      MFGLRRNAVIGLNLYCG-------------------------------------------
P97287_MCL1-01      MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARP
                    *****************                                           

P97287_MCL1-02      ---GAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPA
P97287_MCL1-01      PPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPA
                       *********************************************************

P97287_MCL1-02      VLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL
P97287_MCL1-01      VLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL
                    ************************************************************

P97287_MCL1-02      GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
P97287_MCL1-01      GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
                    ************************************************************

P97287_MCL1-02      NWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFF
P97287_MCL1-01      NWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFF
                    ************************************************************

P97287_MCL1-02      HVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
P97287_MCL1-01      HVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                    *******************************

© 1998-2019