Dataset for protein BCL-2-like of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

22 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P70345_BCL2L2-03       --------------------------------------------------
D3Z5F7_BCL2L2-01       --------------------------------------------------
P97287_MCL1-02         MFGLRRNAVIGLNLYCG---------------------------------
P97287_MCL1-01         MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       --------------------------------------------------
O55179_BCL2A1-01       --------------------------------------------------
O55177_BCL2A1-02       --------------------------------------------------
Q497M6_BCL2A1-01       --------------------------------------------------
Q8K164_BCL2A1-01       --------------------------------------------------
Q4FK02_BCL2A1-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01      --------------------------------------------------
P70345_BCL2L2-01       --------------------------------------------------
P70345_BCL2L2-04       --------------------------------------------------
P10417_BCL2-02         --------------------------------------------------
P10417_BCL2-01         --------------------------------------------------
Q64373_BCL2L1-03       --------------------------------------------------
Q64373_BCL2L1-04       --------------------------------------------------
O35843_BCL2L1-01       --------------------------------------------------
Q64373_BCL2L1-01       --------------------------------------------------
Q64373_BCL2L1-09       --------------------------------------------------
                                                                         

P70345_BCL2L2-03       --------------------------------------------------
D3Z5F7_BCL2L2-01       ----------MATPASTPDTRA-------------------LVADFVGYK
P97287_MCL1-02         -------------GAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
P97287_MCL1-01         LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
O55178_BCL2A1-01       ------------------------------MAEYELMHIHSLAEHYLQYV
Q0P538_BCL2A1-01       ------------------------------MAEYELMHIHSLAEHYLQYV
Q07440_BCL2A1-01       ------------------------------MAESELMHIHSLAEHYLQYV
O55179_BCL2A1-01       ------------------------------MSEYEFMYIHSLAEHYLQYV
O55177_BCL2A1-02       ------------------------------MAEYEFMYIHSLAEHYLQYV
Q497M6_BCL2A1-01       ------------------------------MAEYEFMYIHSLAEHYLQYV
Q8K164_BCL2A1-01       ------------------------------MAEYEFMYIHSLAEHYLQYV
Q4FK02_BCL2A1-01       ------------------------------MSEYEFMYIHSLAEHYLQYV
Q9Z0F3_BCL2L10-01      ---------------------------MADSQDPLHERTRRLLSDYIFF-
P70345_BCL2L2-01       -----------------------------MATPASTPDTRALVADFVGYK
P70345_BCL2L2-04       -----------------------------MATPASTPDTRALVADFVGYK
P10417_BCL2-02         ----------------------------MAQAGRTGYDNREIVMKYIHYK
P10417_BCL2-01         ----------------------------MAQAGRTGYDNREIVMKYIHYK
Q64373_BCL2L1-03       ----------------------------MSQS------NRELVVDFLSYK
Q64373_BCL2L1-04       ----------------------------MSQS------NRELVVDFLSYK
O35843_BCL2L1-01       ----------------------------MSQS------NRELVVDFLSYK
Q64373_BCL2L1-01       ----------------------------MSQS------NRELVVDFLSYK
Q64373_BCL2L1-09       ----------------------------MSQS------NRELVVDFLSYK
                                                                         

P70345_BCL2L2-03       --------------------------------------------------
D3Z5F7_BCL2L2-01       LRQKGYVCGAGP---GEGPAADPL--------------------------
P97287_MCL1-02         VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEE
P97287_MCL1-01         VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEE
O55178_BCL2A1-01       LQVPAF--------------------------------------------
Q0P538_BCL2A1-01       LQVPAF--------------------------------------------
Q07440_BCL2A1-01       LQVPAF--------------------------------------------
O55179_BCL2A1-01       LQVPAF--------------------------------------------
O55177_BCL2A1-02       LQVPAF--------------------------------------------
Q497M6_BCL2A1-01       LQVPAF--------------------------------------------
Q8K164_BCL2A1-01       LQVPAF--------------------------------------------
Q4FK02_BCL2A1-01       LQVPAF--------------------------------------------
Q9Z0F3_BCL2L10-01      --------------------CAREPDTPEPPPTSV---------------
P70345_BCL2L2-01       LRQKGY--------------------------------------------
P70345_BCL2L2-04       LRQKGY--------------------------------------------
P10417_BCL2-02         LSQRGYEW--------DAGDADAAPLGAAPTPGIFSFQPESN--PMPAVH
P10417_BCL2-01         LSQRGYEW--------DAGDADAAPLGAAPTPGIFSFQPESN--PMPAVH
Q64373_BCL2L1-03       LSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVN
Q64373_BCL2L1-04       LSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVN
O35843_BCL2L1-01       LSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVN
Q64373_BCL2L1-01       LSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVN
Q64373_BCL2L1-09       LSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVN
                                                                         

P70345_BCL2L2-03       --------------------------------------------------
D3Z5F7_BCL2L2-01       ----------------------------------------HQAMRAAGDE
P97287_MCL1-02         EEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDG
P97287_MCL1-01         EEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDG
O55178_BCL2A1-01       ---------------------------------ESAPSQAFRVLQRVAFS
Q0P538_BCL2A1-01       ---------------------------------ESAPSQAFRVLQRVAFS
Q07440_BCL2A1-01       ---------------------------------ESAPSQACRVLQRVAFS
O55179_BCL2A1-01       ---------------------------------ESAPSQACRVLQRVAFS
O55177_BCL2A1-02       ---------------------------------ESAPSQACRVLQRVAFS
Q497M6_BCL2A1-01       ---------------------------------ESAPSKACRVLQRVAFS
Q8K164_BCL2A1-01       ---------------------------------ESAPSQACRVLQRVAFS
Q4FK02_BCL2A1-01       ---------------------------------ESAPSKACRVLQRVAFS
Q9Z0F3_BCL2L10-01      ---------------------------------------EAALLRSVTRQ
P70345_BCL2L2-01       -------------------------VCGAGPGEGPAADPLHQAMRAAGDE
P70345_BCL2L2-04       -------------------------VCGAGPGEGPAADPLHQAMRAAGDE
P10417_BCL2-02         RD-----------MAARTS-PLRPLVATAGPALSPVPPVVHLTLRRAGDD
P10417_BCL2-01         RD-----------MAARTS-PLRPLVATAGPALSPVPPVVHLTLRRAGDD
Q64373_BCL2L1-03       GA-----------TGHSSSLDAREVIPMAA---------VKQALREAGDE
Q64373_BCL2L1-04       GA-----------TGHSSSLDAREVIPMAA---------VKQALREAGDE
O35843_BCL2L1-01       GA-----------TGHSSSLDAREVIPMAA---------VKQALREAGDE
Q64373_BCL2L1-01       GA-----------TGHSSSLDAREVIPMAA---------VKQALREAGDE
Q64373_BCL2L1-09       GA-----------TGHSSSLDAREVIPMAA---------VKQALREAGDE
                                                                         

P70345_BCL2L2-03       --------------------------------------------------
D3Z5F7_BCL2L2-01       FETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGG-P-NWGRLVAF
P97287_MCL1-02         VQRNHETAFQGMLRKLDIKN-EGDVKSFSRVMVHVFKDGVT-NWGRIVTL
P97287_MCL1-01         VQRNHETAFQGMLRKLDIKN-EGDVKSFSRVMVHVFKDGVT-NWGRIVTL
O55178_BCL2A1-01       VQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFEDGII-NWGRIVTI
Q0P538_BCL2A1-01       VQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFENGII-NWGRIVTI
Q07440_BCL2A1-01       VQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-NWGRIVTI
O55179_BCL2A1-01       VQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-NWGRIVTI
O55177_BCL2A1-02       VQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-NWGRIVTI
Q497M6_BCL2A1-01       VQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-NWGRIVTI
Q8K164_BCL2A1-01       VQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-NWGRIVTI
Q4FK02_BCL2A1-01       VQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-NWGRIVTI
Q9Z0F3_BCL2L10-01      IQQEHQEFFSSFCE----SR-GNRLELVKQMADKLLSKDQDFSWSQLVML
P70345_BCL2L2-01       FETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGGPN--WGRLVAF
P70345_BCL2L2-04       FETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGGPN--WGRLVAF
P10417_BCL2-02         FSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDGVN--WGRIVAF
P10417_BCL2-01         FSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDGVN--WGRIVAF
Q64373_BCL2L1-03       FELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN--WGRIVAF
Q64373_BCL2L1-04       FELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN--WGRIVAF
O35843_BCL2L1-01       FELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN--WGRIVAF
Q64373_BCL2L1-01       FELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN--WGRIVAF
Q64373_BCL2L1-09       FELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN--WGRIVAF
                                                                         

P70345_BCL2L2-03       -----------------------MEPLV---GQVQDWMVAYLETRL----
D3Z5F7_BCL2L2-01       FVFGAAL--------CAESVNKEMEPLV---GQVQDWMVAYLETRL----
P97287_MCL1-02         ISFGAFV--------AKHLKSVNQESFI---EPLAETITDVLVRTK----
P97287_MCL1-01         ISFGAFV--------AKHLKSVNQESFI---EPLAETITDVLVRTK----
O55178_BCL2A1-01       FAFGGVL--------LKKTSTRADCPGC----------------------
Q0P538_BCL2A1-01       FAFGGVL--------LKKTSTRADCPGC----------------------
Q07440_BCL2A1-01       FAFGGVL--------LKKLPQEQIALDVCAYKQVSSFVAEFIMNNT----
O55179_BCL2A1-01       FAFGGVL--------LKKLPQEQIALDVGAYKQVSSFVAEFIMNNT----
O55177_BCL2A1-02       FAFGGVL--------LKKLPQEQIALDVGAYKQVSSFVAEFIINNT----
Q497M6_BCL2A1-01       FAFGGVL--------LKKLPQEQIALDVGAYKQVSSFVAEFIINNT----
Q8K164_BCL2A1-01       FAFGGVL--------LKKLPQEQIALDVGAYKQVSSFVAEFIINNT----
Q4FK02_BCL2A1-01       FAFGGVL--------LKKLPQEQIALDVGAYKQVSSFVAEFIINNT----
Q9Z0F3_BCL2L10-01      LAFAGTLMNQGPYMAVKQKRDLGNRVIV---TRDCCLIVNFLYNLLMGRR
P70345_BCL2L2-01       FVFGAAL--------CAESVNKEMEPLV---GQVQDWMVAYLETRL----
P70345_BCL2L2-04       FVFGAAL--------CAESVNKEMEPLV---GQVQDWMVAYLETRL----
P10417_BCL2-02         FEFGGVM--------CVESVNREMSPLV---DNIALWMTEYLNRHL----
P10417_BCL2-01         FEFGGVM--------CVESVNREMSPLV---DNIALWMTEYLNRHL----
Q64373_BCL2L1-03       FSFGGAL--------CVESVDKEMQVLV---SRIASWMATYLNDHL----
Q64373_BCL2L1-04       FSFGGAL--------CVESVDKEMQVLV---SRIASWMATYLNDHL----
O35843_BCL2L1-01       FSFGGAL--------CVESVDKEMQVLV---SRIASWMATYLNDHL----
Q64373_BCL2L1-01       FSFGGAL--------CVESVDKEMQVLV---SRIASWMATYLNDHL----
Q64373_BCL2L1-09       FSFGGAL--------CVESVDKEMQVLV---SRIASWMATYLNDHL----
                                                                         

P70345_BCL2L2-03       -ADWIHSSGGWAEFTALYGDGALE--------------------------
D3Z5F7_BCL2L2-01       -ADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNA
P97287_MCL1-02         -RDWLVKQRGWDGFVEFFHVQDLE--------------------------
P97287_MCL1-01         -RDWLVKQRGWDGFVEFFHVQDLE--------------------------
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       -GEWIRQNGGWEDGFIKKFEPKSG--------------------------
O55179_BCL2A1-01       -GEWIRRNGGWEDGFIKKFEPKSG--------------------------
O55177_BCL2A1-02       -GEWIRRNGGWEDGFIKKFEPKSG--------------------------
Q497M6_BCL2A1-01       -GEWIRRNGGWEDGFIKKFEPKSG--------------------------
Q8K164_BCL2A1-01       -GEWIRRNGGWEDGFIKKFEPKSG--------------------------
Q4FK02_BCL2A1-01       -GEWIRRNGGWEDGFIKKFEPKSG--------------------------
Q9Z0F3_BCL2L10-01      HRARLEALGGWDGFCRFFKNPLP---------------------------
P70345_BCL2L2-01       -ADWIHSSGGWAEFTALYGDGALE--------------------------
P70345_BCL2L2-04       -ADWIHSSGGWVRSSQLLLSASL---------------------------
P10417_BCL2-02         -HTWIQDNGGW---------------------------------------
P10417_BCL2-01         -HTWIQDNGGWDAFVELYGPSMRP--------------------------
Q64373_BCL2L1-03       -EPWIQENGGWVR-------------------------------------
Q64373_BCL2L1-04       -EPWIQENGGWVR-------------------------------------
O35843_BCL2L1-01       -EPWIQENGGWGV-------------------------------------
Q64373_BCL2L1-01       -EPWIQENGGWDTFVDLYGNNAAA--------------------------
Q64373_BCL2L1-09       -EPWIQENGGWDTFVDLYGNNAAA--------------------------
                                                                         

P70345_BCL2L2-03       --------------------------------EARRLREGNWASVRTVLT
D3Z5F7_BCL2L2-01       GPVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCD
P97287_MCL1-02         ---------------------------------------GGIRNVLLAFA
P97287_MCL1-01         ---------------------------------------GGIRNVLLAFA
O55178_BCL2A1-01       ----------------------------------TCLQTSFQFWGRIHNE
Q0P538_BCL2A1-01       ----------------------------------TCLQTSFQFWGRIHHE
Q07440_BCL2A1-01       --------------------------------WLTFLQMTGQIWEMLFLL
O55179_BCL2A1-01       --------------------------------WLTFLQMTGQIWEMLFLL
O55177_BCL2A1-02       --------------------------------WLTFLQMTGQFWEMLFLL
Q497M6_BCL2A1-01       --------------------------------WLTFLQMTGQFWEMLFLL
Q8K164_BCL2A1-01       --------------------------------WLTFLQMTGQIWEMLFLL
Q4FK02_BCL2A1-01       --------------------------------WLTFLQMTGQFWEMLFLL
Q9Z0F3_BCL2L10-01      -----------------------------------------LGFWRRLLI
P70345_BCL2L2-01       --------------------------------EARRLREGNWASVRTVLT
P70345_BCL2L2-04       ------------------------------------YKVGLHGKIGPLMG
P10417_BCL2-02         -------------------------------------------------V
P10417_BCL2-01         --------------------------------LFDFSWLSLKTLLSLALV
Q64373_BCL2L1-03       ---------------------------------------------TTPLV
Q64373_BCL2L1-04       ---------------------------------------------TTPLV
O35843_BCL2L1-01       -----------------------------------SGGTPLRSVFRRLVQ
Q64373_BCL2L1-01       --------------------------------ESRKGQERFNRWFLTGMT
Q64373_BCL2L1-09       --------------------------------ESRKGQERFNRWFLTGMT
                                                                         

P70345_BCL2L2-03       GAVALGALVTVGAFFASK--------------------------------
D3Z5F7_BCL2L2-01       KFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIST
P97287_MCL1-02         GVAGVGAGLAYL-------IR-----------------------------
P97287_MCL1-01         GVAGVGAGLAYL-------IR-----------------------------
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       K-------------------------------------------------
O55179_BCL2A1-01       K-------------------------------------------------
O55177_BCL2A1-02       K-------------------------------------------------
Q497M6_BCL2A1-01       K-------------------------------------------------
Q8K164_BCL2A1-01       K-------------------------------------------------
Q4FK02_BCL2A1-01       K-------------------------------------------------
Q9Z0F3_BCL2L10-01      Q-AFLSGFFATAIFFIWKRL------------------------------
P70345_BCL2L2-01       GAVALGALVTVGAFFASK--------------------------------
P70345_BCL2L2-04       GWGCAGKG------------------------------------------
P10417_BCL2-02         G-ACL----VE---------------------------------------
P10417_BCL2-01         G-ACI----TLGAYLGHK--------------------------------
Q64373_BCL2L1-03       C-PPL---ACVSLLCEHP--------------------------------
Q64373_BCL2L1-04       C-PPL---ACVSLLCEHP--------------------------------
O35843_BCL2L1-01       V-PGVAEHVCDPSLWEVETEGSEVQGPPQLL-------------------
Q64373_BCL2L1-01       V-AGV---VLLGSLFSRK--------------------------------
Q64373_BCL2L1-09       V-AGV---VLLGSLFSRK--------------------------------
                                                                         

P70345_BCL2L2-03       --------------------------------------------------
D3Z5F7_BCL2L2-01       TDRGFPRSRYRARTTNYNSSRSRFYSGFNSRPRGRIYRGRARATSWYSPY
P97287_MCL1-02         --------------------------------------------------
P97287_MCL1-01         --------------------------------------------------
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       --------------------------------------------------
O55179_BCL2A1-01       --------------------------------------------------
O55177_BCL2A1-02       --------------------------------------------------
Q497M6_BCL2A1-01       --------------------------------------------------
Q8K164_BCL2A1-01       --------------------------------------------------
Q4FK02_BCL2A1-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01      --------------------------------------------------
P70345_BCL2L2-01       --------------------------------------------------
P70345_BCL2L2-04       --------------------------------------------------
P10417_BCL2-02         --------------------------------------------------
P10417_BCL2-01         --------------------------------------------------
Q64373_BCL2L1-03       --------------------------------------------------
Q64373_BCL2L1-04       --------------------------------------------------
O35843_BCL2L1-01       --------------------------------------------------
Q64373_BCL2L1-01       --------------------------------------------------
Q64373_BCL2L1-09       --------------------------------------------------
                                                                         

© 1998-2019