Dataset for protein Bcl-w of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


D3Z5F7_BCL2L2-01      MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
P70345_BCL2L2-03      --------------------------------------------------
P70345_BCL2L2-01      MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
P70345_BCL2L2-04      MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                                                                        

D3Z5F7_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
P70345_BCL2L2-03      --------------------------------------------------
P70345_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
P70345_BCL2L2-04      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                                                                        

D3Z5F7_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWELEAIK
P70345_BCL2L2-03      --------------MEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTAL
P70345_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTAL
P70345_BCL2L2-04      VFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWVRSSQL
                                    ******************************   :  

D3Z5F7_BCL2L2-01      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARS
P70345_BCL2L2-03      YGDGALEEARR----------------------------LREGNWASVRT
P70345_BCL2L2-01      YGDGALEEARR----------------------------LREGNWASVRT
P70345_BCL2L2-04      LLSASL---------------------------------YKVGLHGKIGP
                           :                                       ..  .

D3Z5F7_BCL2L2-01      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
P70345_BCL2L2-03      VLTGAVALGALVT-------------------------------------
P70345_BCL2L2-01      VLTGAVALGALVT-------------------------------------
P70345_BCL2L2-04      LMGGWGCAGKG---------------------------------------
                      :  *    *                                         

D3Z5F7_BCL2L2-01      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRSRYRARTTNY
P70345_BCL2L2-03      --------------------------------------------------
P70345_BCL2L2-01      --------------------------------------------------
P70345_BCL2L2-04      --------------------------------------------------
                                                                        

D3Z5F7_BCL2L2-01      NSSRSRFYSGFNSRPRGRIYRGRARATSWYSPY
P70345_BCL2L2-03      -------------------------VGAFFASK
P70345_BCL2L2-01      -------------------------VGAFFASK
P70345_BCL2L2-04      ---------------------------------
                                                       

© 1998-2019