Dataset for protein Bcl-xL of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q64373_BCL2L1-03      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSA
Q64373_BCL2L1-04      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSA
O35843_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSA
Q64373_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSA
Q64373_BCL2L1-09      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSA
                      **************************************************

Q64373_BCL2L1-03      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q64373_BCL2L1-04      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
O35843_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q64373_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q64373_BCL2L1-09      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                      **************************************************

Q64373_BCL2L1-03      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q64373_BCL2L1-04      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
O35843_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q64373_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q64373_BCL2L1-09      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                      **************************************************

Q64373_BCL2L1-03      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWVR----------
Q64373_BCL2L1-04      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWVR----------
O35843_BCL2L1-01      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWGV----------
Q64373_BCL2L1-01      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAA
Q64373_BCL2L1-09      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAA
                      **************************************            

Q64373_BCL2L1-03      --------------TTPLVCPPL---ACVSLLCEHP-------------
Q64373_BCL2L1-04      --------------TTPLVCPPL---ACVSLLCEHP-------------
O35843_BCL2L1-01      ----SGGTPLRSVFRRLVQVPGVAEHVCDPSLWEVETEGSEVQGPPQLL
Q64373_BCL2L1-01      AESRKGQERFNRWFLTGMTVAGV---VLLGSLFSRK-------------
Q64373_BCL2L1-09      AESRKGQERFNRWFLTGMTVAGV---VLLGSLFSRK-------------
                                       :  . :   .    * .               

© 1998-2019