Dataset for protein BCL-2-like of organism Monopterus albus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3IZW0_MCL1-01      MNIITSKKWADVNVTTEIMSLILPQNGVVEGSMHCGSNTSPQFAVGSSID
A0A3Q3J5K3_BCL2L1-      -MSYSHRELVEFYISYKLSQRNYSTSLLRPENAGGRTEGDRTNPATT---
A0A3Q3JQ78_BCL2L10      -MCREHLDIAGRKMSCGLWKDTLAL-------------------AEDYLS
A0A3Q3IVF5_BCL2L1-      --MSQNKELVVFYITYKLSQKNYPLSHLGLNESPNRTDGE----EATHAN
A0A3Q3K1K1_BCL2-01      MANECNRNVVEKYICHKLSKRGYVWGFHDVQDEDAANNGSIVAPPPTLVR
                               . .   :   : .                              

A0A3Q3IZW0_MCL1-01      SCKGNVGPNNTLKRPKILDVSSTNGYGTKTLVDVSDIDNGSLPCSPVLQP
A0A3Q3J5K3_BCL2L1-      --------------------------------------------------
A0A3Q3JQ78_BCL2L10      LCCTSSRPAPPPPSE-----------------------------------
A0A3Q3IVF5_BCL2L1-      GTFNGTSPGTPPASP-----------------------------------
A0A3Q3K1K1_BCL2-01      RCREASTGPDSESTP-----------------------------------
                                                                          

A0A3Q3IZW0_MCL1-01      DNEIEVSSSPAEYEVLENDTRLLICHFLRDYTGLSTHRWTRRKTLSTMKR
A0A3Q3J5K3_BCL2L1-      ----------------------------------------NGLGIEAVKA
A0A3Q3JQ78_BCL2L10      ---------------------------------SAA--------------
A0A3Q3IVF5_BCL2L1-      ---------------------------------LRQQQLPSTANLDAVKE
A0A3Q3K1K1_BCL2-01      ---------------------------------HRCKRPPQSDMHAAIHR
                                                                          

A0A3Q3IZW0_MCL1-01      VVEGVLEKHRYAYKGMINKLSLD----ERGDDMSFVGSVAQSIFADGTTN
A0A3Q3J5K3_BCL2L1-      ALRDSADEFELRFTQAFSDLSSQ-LVITPDTAYNSFKSVMDEVFKDG-VN
A0A3Q3JQ78_BCL2L10      AMRCLAQDMETQHQARFHSLAQTFLKQCGPDPCSSLRKVMEELVGDGHLN
A0A3Q3IVF5_BCL2L1-      ALRDSANEFELRYARAFSDLHHQ-LHITPATAYQSFESVMDEVFRDG-VN
A0A3Q3K1K1_BCL2-01      VLREAGDELERLYQPDFTEMSRQ-LHLTSTTAQRRFAEVIDELFRDG-VN
                        .:    :.    .   : .:               . .* :.:. **  *

A0A3Q3IZW0_MCL1-01      WGRITSLLAFGAVVCQYLKEK-GRENCVE---------------LVGQEI
A0A3Q3J5K3_BCL2L1-      WGRIVGLFAFGGALCVECVEK-NMSELVS---------------RIADWM
A0A3Q3JQ78_BCL2L10      WGRVVSLFAFTGVLARQLTEQNGMKPGLDPGQGQELGQGPGNCRELAETI
A0A3Q3IVF5_BCL2L1-      WGRIIGLFAFGGALCVECVEK-EMSPLVG---------------RIVEWM
A0A3Q3K1K1_BCL2-01      WGRIIAFFEFGGTMCVECAAKEEMTPQVD---------------KIAEWM
                        ***: .:: * ..:.     :      :                 : : :

A0A3Q3IZW0_MCL1-01      STYLLSHQRDWLVKNNAWDGFEEFFRVADPESTVRTTLMAFAGFAGIGAT
A0A3Q3J5K3_BCL2L1-      TMYLDEHISPWIQNQGGWDCFAEIFG-RDNAAEVRRSQETLRRWLLVGVV
A0A3Q3JQ78_BCL2L10      ADYLGEEKKDWLLENDGWEGFCKFSR-SAREVSHDSSVKT--ALFAAAGV
A0A3Q3IVF5_BCL2L1-      TVYLDNHIQPWIQGQGGWERFAELFG-QDAAAENRRSQESFKKWLLAGMT
A0A3Q3K1K1_BCL2-01      TEYLNGPLNSWIQENGGWDAFVELYD-RQRESVFSCSWPSIKTVFGLAAL
                        : **      *:  :..*: * ::            :  :       .  

A0A3Q3IZW0_MCL1-01      LALLIRTNNTCGGLKRKWSRASPW
A0A3Q3J5K3_BCL2L1-      LLTGV--------LVGVLVAKKL-
A0A3Q3JQ78_BCL2L10      GLAGLTFLLETSGTCEREQFRKSD
A0A3Q3IVF5_BCL2L1-      LVTGV--------VVGSLIIQKRL
A0A3Q3K1K1_BCL2-01      GAASL--------TIGAYLTQK--
                            :                .  

© 1998-2019