Dataset for protein Bcl-xL of organism Monopterus albus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3IVF5_BCL2L1-      -MSQNKELVVFYITYKLSQKNYPLSHLGLNESPNRTDGEEATHANGTFNG
A0A3Q3J5K3_BCL2L1-      MSYSHRELVEFYISYKLSQRNYSTSLLRPENAGGRTEGDRTNPATTNGLG
                           .:.*** ***:*****.**. * *  ::: .**:*: :. *. .  *

A0A3Q3IVF5_BCL2L1-      TSPGTPPASPLRQQQLPSTANLDAVKEALRDSANEFELRYARAFSDLHHQ
A0A3Q3J5K3_BCL2L1-      ---------------------IEAVKAALRDSADEFELRFTQAFSDLSSQ
                                             ::*** ******:*****::.*****  *

A0A3Q3IVF5_BCL2L1-      LHITPATAYQSFESVMDEVFRDGVNWGRIIGLFAFGGALCVECVEKEMSP
A0A3Q3J5K3_BCL2L1-      LVITPDTAYNSFKSVMDEVFKDGVNWGRIVGLFAFGGALCVECVEKNMSE
                        * *** ***:**:*******.********:****************:** 

A0A3Q3IVF5_BCL2L1-      LVGRIVEWMTVYLDNHIQPWIQGQGGWERFAELFGQDAAAENRRSQESFK
A0A3Q3J5K3_BCL2L1-      LVSRIADWMTMYLDEHISPWIQNQGGWDCFAEIFGRDNAAEVRRSQETLR
                        **.**.:***:***:**.****.****: ***:**.* *** *****::.

A0A3Q3IVF5_BCL2L1-      KWLLAGMTLVTGVVVGSLIIQKRL
A0A3Q3J5K3_BCL2L1-      RWLLVGVVLLTGVLVG-VLVAKKL
                        .***.*:.*:***:** ::: *.*

© 1998-2019