Dataset for protein BCL-2-like of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6ZMX1_MCL1-01         -----MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPT
F6SFL4_BCL2A1-01       ---MDDYEFHYVHMLARDYLKHVQQTPPL---------------------
F6VJQ0_BCL2L10-01      -MDYKCALREETARLVTDYLEYCCRREGV---------------------
F6U940_BCL2L2-01       --MATPASAPDTRALVADFVGYKLRQKGY---------------------
F6WA14_BCL2L1-01       -------MSHSNRELVIDFLSYKLSQKGYNWSQFEDENRTEVLEGAEIPS
F6YNL8_BCL2-01         MMAHPGRRGYDNREIVMKYIHYKLSQRGYEW----DAGDLRAPASPSLPP
                                     :    :                              

F6ZMX1_MCL1-01         VESTPPQRDGGEVETGTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGA
F6SFL4_BCL2A1-01       --------------------------------------------------
F6VJQ0_BCL2L10-01      --------------------------------------------------
F6U940_BCL2L2-01       -------------------------------------------------A
F6WA14_BCL2L1-01       TVNGSPSW--------------HPADSRAVSGATGHSSSLDAHETIPVAA
F6YNL8_BCL2-01         VVASAPAVGIFSTQPRNTPLPAEPQDSATSTTAAARNSPLPLPPPAVAAA
                                                                         

F6ZMX1_MCL1-01         EAPDVTTDPMPSLFAPGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPG
F6SFL4_BCL2A1-01       -------GSCLN--------------------------------------
F6VJQ0_BCL2L10-01      -----QELPAPT--------------------------------------
F6U940_BCL2L2-01       CGTGPGEGPTTE--------------------------------------
F6WA14_BCL2L1-01       --------------------------------------------------
F6YNL8_BCL2-01         AAAGPTVSPVPP--------------------------------------
                                                                         

F6ZMX1_MCL1-01         KRPSRLAVLEIAREGGDSPNGSLPSTPPPAEEDEEEDELYGQSLELISRY
F6SFL4_BCL2A1-01       --------------------------------------------------
F6VJQ0_BCL2L10-01      --------------------------------------------------
F6U940_BCL2L2-01       --------------------------------------------------
F6WA14_BCL2L1-01       --------------------------------------------------
F6YNL8_BCL2-01         --------------------------------------------------
                                                                         

F6ZMX1_MCL1-01         LREQAVGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKLDIKN-
F6SFL4_BCL2A1-01       -----------------KTSQILQKVAFSVQQEVEKDMETCLSTLDIVSV
F6VJQ0_BCL2L10-01      -----------------PAAATLRLVSSELRQIYQDFFECALNQL--LD-
F6U940_BCL2L2-01       -----------------PLHRAMRAAGDEFESRFRRTFSDLAAQLHVTP-
F6WA14_BCL2L1-01       ------------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-
F6YNL8_BCL2-01         -----------------VVHLTLRQAGDDFSRRYRRDFDEMSGQLHLTP-
                                             :. ..  .       :.     *     

F6ZMX1_MCL1-01         EEDIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESC---
F6SFL4_BCL2A1-01       ESARRIFNSVMKKEFEDGVINWGRIVTIFAFGGIL---IKKLLRHRAPLT
F6VJQ0_BCL2L10-01      REPEQVIVNVAELMDRGEF-NWGRVAVLVVFAGALLE-MEELLKEEQVLQ
F6U940_BCL2L2-01       GSAQQRFTQVSDELFQGGP-NWGRLVAFFVFGAALC--AESVNKEMEPL-
F6WA14_BCL2L1-01       GTAYQSFEQVVNELFRDGV-NWGRIVAFFSFGGALC--VESVDKEMEVL-
F6YNL8_BCL2-01         VTARGRFATVVEELFRDGV-NWGRIVAFFEFGGVMC--VESVNREMSPL-
                             .  *      .   ****:..:. *.. :    :.: .      

F6ZMX1_MCL1-01         -----IDPLAESITDVLVKTKRDWLIKQKGWE-GFVEFFHVQDLEGG---
F6SFL4_BCL2A1-01       MGT--QEEISHFIAEFIMNNIAEWIRQNGGWENGFVKNFEPNT-------
F6VJQ0_BCL2L10-01      LRRETSRRLTEKLCNYLVERKGAWLHENGGWT-GFHHHF------EKRQS
F6U940_BCL2L2-01       -----VGQVQDWMVTYLETQLADWIHSSGGWA-EFTALYGDGALEEA---
F6WA14_BCL2L1-01       -----VGRITSWMATYLDDHLDPWIQENGGWD-TFVELYGNDAAAESRKG
F6YNL8_BCL2-01         -----VDSIALWMTEYLNRHLHTWIQDNGGWD-AFVELYGNSM-------
                               :   :   :      *: .. **   *   :           

F6ZMX1_MCL1-01         ----------IRNVLLAFA-GVAGVGAGLAYLIR
F6SFL4_BCL2A1-01       ------VWPNFTDISTKIW--------GIFSFLK
F6VJQ0_BCL2L10-01      PPPSDSSNNTLCCIMAAAA-GFGLVGLALLLVVR
F6U940_BCL2L2-01       RRLREGNWASVRTVLTGAVALGALVTVGAFFASK
F6WA14_BCL2L1-01       QERFN------RWLLTGMT-VAGVVLLGSLFSRK
F6YNL8_BCL2-01         RPLFDFSWLSLKTLLSLAL-VGACVTLGAYLGHK
                                    :             .     .

© 1998-2019