Dataset for protein BCL-2-like of organism Mola mola

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3VP02_MCL1-01      --------MNVLFQNGVVSGPTRSSQIGMGSCLDSHNGNVALNDTSKRPN
A0A3Q3WIW8_BCL2L1-      -MSVNRELVAYYINYKLSHRGCPLNHMGLIEPPNRTEGGQAVSDEEQR--
A0A3Q3VI28_BCL2L10      ------MSCGLWKETLALAQDYLS--------------------------
A0A3Q3X5M5_BCL2L1-      MSHSNRELVEFFISYKLTQKNYPTSLLRPEDTGGRTEGDKASSAARNG--
                                     .                                    

A0A3Q3VP02_MCL1-01      LLVVNPTKEYMGKPIRKDSTDTDDDGSLPYTPDMSPDSELNVSGCLAGDE
A0A3Q3WIW8_BCL2L1-      -VATHANGTFNGT-----------------SPGTPPRSPLRLQPSTTSLD
A0A3Q3VI28_BCL2L10      --LCCTS-----Q-----------------RPAPPP-------PSESA--
A0A3Q3X5M5_BCL2L1-      -LLVNSS-----S-----------------RGGLSP-------STGADME
                             ..                           .*          :   

A0A3Q3VP02_MCL1-01      LLEKDTRQLISRVLMELSGHGRARWTESRTLSTMKRVVAELLEKHRYVYN
A0A3Q3WIW8_BCL2L1-      AVK----------------------------DALRDSANEFELRYARAFS
A0A3Q3VI28_BCL2L10      -------------------------------AAMRDLAQDMEKQHQARFH
A0A3Q3X5M5_BCL2L1-      AVK----------------------------SALRDSANEFEQLFTQAFS
                                                        ::.  . ::   .   : 

A0A3Q3VP02_MCL1-01      GMTKRLSLADTQDNVSFVSTVSRDLFSDGATNWGRIASLVAFGVVVSQCL
A0A3Q3WIW8_BCL2L1-      DLHNQ-LHITPATAYQSFENVMDEVFRDG-VNWGRIVGLFAFGGALCVEC
A0A3Q3VI28_BCL2L10      SLAQTFLRQCGTDPCSSLRNVMEELVGDGHLNWGRVVSIFTFTGVLARQL
A0A3Q3X5M5_BCL2L1-      DLSSQ-LDITPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGGVLCVEC
                        .: .             . .*  ::. **  ****:..:.:*  .:.   

A0A3Q3VP02_MCL1-01      KENGKSDR------------------VELVAHEISTYLLTDQRDWMCVGG
A0A3Q3WIW8_BCL2L1-      VEKEMSPL------------------VGRIIEWMTVYLDNQIQPWIESQG
A0A3Q3VI28_BCL2L10      LEQKSTKPGLEPRQDQDQELGQVPGNCSELAETIADYLGEEKKAWLLEND
A0A3Q3X5M5_BCL2L1-      AEKDTGEL------------------VCRIADWMTTYLDEHINPWIQSQG
                         *:                          :   :: **    . *:   .

A0A3Q3VP02_MCL1-01      --DGFVEFFRVADPESTVRN----ALMTIAGVAG-----IGATLALLIR
A0A3Q3WIW8_BCL2L1-      GWQRFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIVQKRL
A0A3Q3VI28_BCL2L10      GWEGFCK-FSHSAREARLDSSMKTALFAAAGVGL-----AGLTFLLVR-
A0A3Q3X5M5_BCL2L1-      GWGCFAEVFGHNAAAEARRSQETLNRWLLVGVALLMGVMVGVFIAKKQ-
                            * : *          .         .*:        *  :     

© 1998-2019