Dataset for protein Bcl-xL of organism Mola mola

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3WIW8_BCL2L1-      -MSVNRELVAYYINYKLSHRGCPLNHMGLIEPPNRTEGGQAVSDEEQRVA
A0A3Q3X5M5_BCL2L1-      MSHSNRELVEFFISYKLTQKNYPTSLLRPEDTGGRTEGDKASSAARNGLL
                            ***** ::*.***::.. * . :   :. .****.:* *   : : 

A0A3Q3WIW8_BCL2L1-      THANGTFNGTSPGTPPRSPLRLQPSTTSLDAVKDALRDSANEFELRYARA
A0A3Q3X5M5_BCL2L1-      VNSSSR-GGLSPST-----------GADMEAVKSALRDSANEFEQLFTQA
                        .::..  .* **.*            :.::***.**********  ::.*

A0A3Q3WIW8_BCL2L1-      FSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVEC
A0A3Q3X5M5_BCL2L1-      FSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVEC
                        **** .** *** ***:**:.******.****************.*****

A0A3Q3WIW8_BCL2L1-      VEKEMSPLVGRIIEWMTVYLDNQIQPWIESQGGWQRFAEIFGQDAAAESR
A0A3Q3X5M5_BCL2L1-      AEKDTGELVCRIADWMTTYLDEHINPWIQSQGGWGCFAEVFGHNAAAEAR
                        .**: . ** ** :***.***::*:***:*****  ***:**::****:*

A0A3Q3WIW8_BCL2L1-      RSQESFKKWLLAGMTLVTGVVVGSLIVQKRL
A0A3Q3X5M5_BCL2L1-      RSQETLNRWLLVGVALLMGVMVGVFIAKKQ-
                        ****:::.***.*::*: **:** :*.:*. 

© 1998-2019