Dataset for protein BCL-2-like of organism Mesocricetus auratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U7QU73_BCL2L1-      -----MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGAESER
A0A1U7QVA0_BCL2L10      MADPLRVR-TRLLLTDYLTFCARE----------------------PGDP
A0A1U7RC37_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------CGAGPG
A0A1U7RC37_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------CGAGPG
                                 .* *:.*:: :   :                       .  

A0A1U7QU73_BCL2L1-      ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGD
A0A1U7QVA0_BCL2L10      EPPPT---------------------------------SAEAALLRSVAE
A0A1U7RC37_BCL2L2-      EGPAA---------------------------------DPLHQAMRAAGD
A0A1U7RC37_BCL2L2-      EGPAA---------------------------------DPLHQAMRAAGD
                        * *.:                                  .    :* ..:

A0A1U7QU73_BCL2L1-      EFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV--NWGRIVAF
A0A1U7QVA0_BCL2L10      QIQQQHHFFFSSFVG----YQGNRVELMTQMVDAVLPDGQDLNWGRLVLL
A0A1U7RC37_BCL2L2-      EFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP--NWGRLVAF
A0A1U7RC37_BCL2L2-      EFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP--NWGRLVAF
                        ::: ...  **.:..      *.  : : *: : :: .*   ****:* :

A0A1U7QU73_BCL2L1-      FSFGGALCVESVDKEMQVLVSRIAS------WMATYLNDHLEPWIQDNGG
A0A1U7QVA0_BCL2L10      LAFAGTIVSQEQRNRLKDKMKVLQDCQLIVALLCNRLLRRHRSWLEAQGG
A0A1U7RC37_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQD------WMVTYLETRLADWIHSSGG
A0A1U7RC37_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQD------WMVTYLETRLADWIHSSGG
                        : *..::  :.  : ::  :  : .       : . *  .   *:  .**

A0A1U7QU73_BCL2L1-      WD-TFVELYGNNAAAESRKGQERFN-------------------------
A0A1U7QVA0_BCL2L10      WD-GFCVIFGSPL----------------------PLDFWSTLLI-----
A0A1U7RC37_BCL2L2-      WA-EFTALYGDGALEEARRLRE---------------GNWASV-------
A0A1U7RC37_BCL2L2-      WELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEK
                        *                                                 

A0A1U7QU73_BCL2L1-      -----RWFLTGMTVAGVVLL------------------------------
A0A1U7QVA0_BCL2L10      -----KTFLSCVIATAILFV------------------------------
A0A1U7RC37_BCL2L2-      -----RTVLTGAVALGALVT------------------------------
A0A1U7RC37_BCL2L2-      MEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFA
                             . .       .                                  

A0A1U7QU73_BCL2L1-      --------------------------------------------------
A0A1U7QVA0_BCL2L10      --------------------------------------------------
A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      YIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARY
                                                                          

A0A1U7QU73_BCL2L1-      ---------------------------------GSLFSRK
A0A1U7QVA0_BCL2L10      -----------------------------------WKRLL
A0A1U7RC37_BCL2L2-      --------------------------------VGAFFASK
A0A1U7RC37_BCL2L2-      RARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                                                                

© 1998-2019