Dataset for protein BCL-2-like of organism Meleagris gallopavo

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1N5N5_BCL2L1-01      MSSSNRELVIDFVSYKLSQKGHCWSELEEEDENRTDTAAEAEMDSVLNGS
G1N8C5_BCL2A1-01      --------------------------------------------------
G1MPY7_MCL1-01        --------------------------------------------------
G1MZW1_BCL2-01        --------------------------------------------------
                                                                        

G1N5N5_BCL2L1-01      PSWHPPAGHVVNGAAVHRSSLEVHEIVRASDVRQTLRDAGDEFELRYRRA
G1N8C5_BCL2A1-01      --------------METAEFYYVYYLAQDYLQYVLQESRLGPAQTRVAHV
G1MPY7_MCL1-01        --------------------------------------------------
G1MZW1_BCL2-01        --------------------------------------------------
                                                                        

G1N5N5_BCL2L1-01      FSDLTSQLHITPGTAYQSFEQ----------------VVNELFHDGV-NW
G1N8C5_BCL2A1-01      LRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFADGNTNW
G1MPY7_MCL1-01        FSGMLRKLEIKKEEDLQAVCE----------------VAAHVFSDGVTNW
G1MZW1_BCL2-01        --------------------------------------VEELFRDGV-NW
                                                                * **  **

G1N5N5_BCL2L1-01      GRIVAFFSFGGALCVESVDKEMR---VLVGRIVSWMTTYLTDHLDPWIQE
G1N8C5_BCL2A1-01      GRIMTIFTFGGLLTKKLQEQGVQLTGEEKEQISYFITEYIINNKAAWIDA
G1MPY7_MCL1-01        GRVVTLISFGAFVAKHLKSINQE---KCISSLAGIITDALVSSKREWLMS
G1MZW1_BCL2-01        GRIVAFFEFGGVMCVESVNREMS---PLVDNIATWMTEYLNRHLHNWIQD
                      **::::: **. :     .            :   :*  :      *:  

G1N5N5_BCL2L1-01      NGGWE-RFVDLY----GNNAAAELRKGQETFNKWLLTGATVAGVLLLGSL
G1N8C5_BCL2A1-01      NGGWENGFLTKF------------------ERRSPLSFSTITDIFAAVFS
G1MPY7_MCL1-01        QGGWE-GFVDFFRVEDLESSIRNV-------------LMAFAGVAGLGAS
G1MZW1_BCL2-01        NGGWD-AFVELY-----GTSMRPLFDFSWISLKTILSLVLVGACITLGAY
                      :***:  *:  :                            .         

G1N5N5_BCL2L1-01      LSRK--
G1N8C5_BCL2A1-01      LFRDYY
G1MPY7_MCL1-01        LAYMIR
G1MZW1_BCL2-01        LGHK--
                      *     

© 1998-2019