Dataset for protein BCL-2-like of organism Maylandia zebra

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P9D632_BCL2L1-      ---MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQR
A0A3P9D632_BCL2L1-      ---MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQR
A0A3P9DIG5_BCL2-01      -MENEYNRNIVEKYICHKLSKRGFVWGFRVVQEEDAANNGSIT--DPPPT
A0A3P9BLI0_BCL2L10      -MIYGLFVTLFCTIPNHDHTSAGY---SVAV----------VSSFHSPHD
A0A3P9BVM3_MCL1-01      MANYMMLKRNQCTLMEYLIPQNGVLEGPMHY----------GSGNSSPQN
                                        :  .. .                   :       

A0A3P9D632_BCL2L1-      IDTHANGTFNGTSPGTPPASPQRRQQQPPSTTDLDAVK------------
A0A3P9D632_BCL2L1-      IDTHANGTFNGTSPGTPPASPQRRQQQPPSTTDLDAVK------------
A0A3P9DIG5_BCL2-01      LVHRCREASTGPDGESNTHLCRRLPQSDPHA----GIH------------
A0A3P9BLI0_BCL2L10      VPSTKIMSRGGVTHSASAEGKTQLYRRSPSA----VCMCREQSDIAGRKM
A0A3P9BVM3_MCL1-01      ATGSSKDSSNGIVSNGTPKRPDNLEVTSTNGYKTKAIRDREEDGSLPSTP
                               :  *      .    .     .                     

A0A3P9D632_BCL2L1-      ------------------------------------------EALRDTAN
A0A3P9D632_BCL2L1-      ------------------------------------------EALRDTAN
A0A3P9DIG5_BCL2-01      ------------------------------------------RVLREAGD
A0A3P9BLI0_BCL2L10      KFCG-------LWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGW
A0A3P9BVM3_MCL1-01      EFHSDSESDEQLERETKLLIHSFLG-DFIGLSQPQRKETKALKTMKRVVA
                                                                   .:.    

A0A3P9D632_BCL2L1-      EFELRYARAFSDLHSQLHITPATAYQSF-ENVMDEVFRDG-VNWGRIVGL
A0A3P9D632_BCL2L1-      EFELRYARAFSDLHSQLHITPATAYQSF-ENVMDEVFRDG-VNWGRIVGL
A0A3P9DIG5_BCL2-01      ELERLYQPDFTEMSRQLHLTSSTAQRRF-AEVIDELFRDG-VNWGRIIAF
A0A3P9BLI0_BCL2L10      DIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVVSL
A0A3P9BVM3_MCL1-01      DVLEKHRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSF
                        :.   :   :  :   : :            * ..:. *   ****::.:

A0A3P9D632_BCL2L1-      FAFGGALCVECV-----------EKE-MSPL-VGRIVEWMTVYLDNHIQP
A0A3P9D632_BCL2L1-      FAFGGALCVECV-----------EKE-MSPL-VGRIVEWMTVYLDNHIQP
A0A3P9DIG5_BCL2-01      FEFGGTVCVECA-----------SNEGMSSQ-VDNIADWMTEYLNGPLNS
A0A3P9BLI0_BCL2L10      FAFTGVLARKILEQKPGLDPRQQQELGQEPMSCRRLAETIADYLGEEKKD
A0A3P9BVM3_MCL1-01      MAFGAVVSQHL------------KEKGRDNY-VALVSQEISAYLLSEQRD
                        : * ..:.               .:   .      : : :: **    . 

A0A3P9D632_BCL2L1-      WIQSQGGWERFAEIFGQ----DAAAESRRSQESFKKWLLVGMTVVTGVVA
A0A3P9D632_BCL2L1-      WIQSQGGWERFAEIFGQ----DAAAESRRSQESFKKWLLVGMTVVTGVVA
A0A3P9DIG5_BCL2-01      WIQDNGGWDAFVELYDR----QRDSVFSCSWPSIKTVFGLAALGAASLTI
A0A3P9BLI0_BCL2L10      WLLDNDGWEGFCKFSRSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR--
A0A3P9BVM3_MCL1-01      WIVKNNAWDGFVEFFRVA---DPESIVRHTLMAFAGFAGIGATLALLISC
                        *: .:..*: * ::       .  :    :  :       .         

A0A3P9D632_BCL2L1-      GALIAQKRL
A0A3P9D632_BCL2L1-      GALIAQKRL
A0A3P9DIG5_BCL2-01      GAYLTQK--
A0A3P9BLI0_BCL2L10      ---------
A0A3P9BVM3_MCL1-01      WDALL----
                                 

© 1998-2019