Dataset for protein BCL-2-like of organism Mastacembelus armatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3M6G2_MCL1-02      MSFIPSTRRAALIPGVMIVLPQDGVLEGPVHYDSRDPSTQFTLDSRNGNG
A0A3Q3M6G2_MCL1-01      MSFIPSTRRAALIPGVMIVLPQDGVLEGPVHYDSRDPSTQFTLDSRNGNG
A0A3Q3KZW1_BCL2L10      ----------------MSCGLWKETLALAEDY------------------
A0A3Q3MEY1_BCL2-01      ----------------MANECNRNIVEKYICHKLSKRGYVWGFHNVQDED
A0A3Q3MX20_BCL2L1-      ------------------MSQNRELVVFYIKYKLSQRNYPLIYIELNEQQ
A0A3Q3NFM4_BCL2L1-      -----------------MSYSNRELVEFFISYKLSQKNYPTSLLRPEDAG
A0A3Q3NFM4_BCL2L1-      -----------------MSYSNRELVEFFISYKLSQKNYPTSLLRPEDAG
                                             .   :     :                  

A0A3Q3M6G2_MCL1-02      GTANPKRPKNLEVSSTNGYATKSIVADTDDIEDGSLPCTPELQSDSEAPS
A0A3Q3M6G2_MCL1-01      GTANPKRPKNLEVSSTNGYATKSIVADTDDIEDGSLPCTPELQSDSEAPS
A0A3Q3KZW1_BCL2L10      -------------------LSLCCTSPQSVPPPPS---------------
A0A3Q3MEY1_BCL2-01      AANNGSVVAPPPT------VVRRCRDASTGPDSESIPQLCRGLPQSDP--
A0A3Q3MX20_BCL2L1-      NRTDGGEAESGEEQRIATHANGTFNGTSPGTPPASPLRQEHLQSTASL--
A0A3Q3NFM4_BCL2L1-      GRTEGDMTGAAATNGLL--VNSRYVSGRPGMSSS---------PHGGV--
A0A3Q3NFM4_BCL2L1-      GRTEGDMTGAAATNGLL--VNSRYVSGRPGMSSS---------PHGGV--
                                                                          

A0A3Q3M6G2_MCL1-02      CPAGDEVLENDTRQLICQYLKDVSGLSKPRWHDSKALSTMKRVVEDLLEK
A0A3Q3M6G2_MCL1-01      CPAGDEVLENDTRQLICQYLKDVSGLSKPRWHDSKALSTMKRVVEDLLEK
A0A3Q3KZW1_BCL2L10      ----------------------------------ESAAAMRCLAQKMERQ
A0A3Q3MEY1_BCL2-01      --------------------------------QAAIHRVLREAGDELERL
A0A3Q3MX20_BCL2L1-      --------------------------------D-AVKEALRDSANEFELR
A0A3Q3NFM4_BCL2L1-      --------------------------------E-AVKAALRDSAEEFELL
A0A3Q3NFM4_BCL2L1-      --------------------------------E-AVKAALRDSAEEFELL
                                                              .:.   :.:   

A0A3Q3M6G2_MCL1-02      YRYTYNGMINKLSLDDRGDDVRFVSTVAKSLFADGTTNWGRIASLVAFGA
A0A3Q3M6G2_MCL1-01      YRYTYNGMINKLSLDDRGDDVRFVSTVAKSLFADGTTNWGRIASLVAFGA
A0A3Q3KZW1_BCL2L10      HQARFHSLTQTFLKQCGPDPCSSLRKVIEELVADGHLNWGRVVSLFTFTG
A0A3Q3MEY1_BCL2-01      YQPDFTEMSRQ-LYLTSTTAQRRFAEVIDELFRDG-VNWGRIIAFFEFGG
A0A3Q3MX20_BCL2L1-      YARAFSDLHNQ-LHITPATAYQSFESVMDEVFRDG-VNWGRIIGLFAFGG
A0A3Q3NFM4_BCL2L1-      FTQAFSDLSSQ-LDITPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGG
A0A3Q3NFM4_BCL2L1-      FTQAFSDLSSQ-LDITPDTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFGG
                        .   :  :               .  * ..:. **  ****: .:. * .

A0A3Q3M6G2_MCL1-02      VVCQYLKEK-GRGDCVEL---------------VGQEISTYLLSDQRDWL
A0A3Q3M6G2_MCL1-01      VVCQYLKEK-GRGDCVEL---------------VGQEISTYLLSDQRDWL
A0A3Q3KZW1_BCL2L10      VLSRQLMEQKGMKPGLDSGKGQELGQGPESCRGLAETIADYLGEEKKDWL
A0A3Q3MEY1_BCL2-01      TVCVECAAKEEMTSQVDN---------------IAEWMTEYLNGPLNSWI
A0A3Q3MX20_BCL2L1-      ALCVECVEK-EMSPLVGR---------------IVEWMTLYLDNHIEPWI
A0A3Q3NFM4_BCL2L1-      VLCVECIEK-NMSALVSR---------------IADWMTMYLDEHISPWI
A0A3Q3NFM4_BCL2L1-      VLCVECIEK-NMSALVSR---------------IADWMTMYLDEHISPWI
                        .:.     :      :                 : : :: **      *:

A0A3Q3M6G2_MCL1-02      VKNNSWDGFVEFFRVADPESTVRHTLMAVAGVAGLGATLALLISYCGVM-
A0A3Q3M6G2_MCL1-01      VKNNSWDGFVEFFRVADPESTVRHTLMAVAGVAGLGATLALLISRNNKML
A0A3Q3KZW1_BCL2L10      QENDGWEGFCKFSH-SAREVSHDSSMKT-------ALFAAAGVGLAGLTF
A0A3Q3MEY1_BCL2-01      QDNGGWDAFVEMYD-RQRESVFSCSWPSIKTVFGLAALGAASITIGAYLT
A0A3Q3MX20_BCL2L1-      QSQGGWEHFAEIFG-QDAAAESRRSQENFKKWLLAGMTLVTGVVVGSLIA
A0A3Q3NFM4_BCL2L1-      ESQGGWDCFAEIFG-RDAAAEARRSQETLRRWLLVGVALLTGVLIGVLIA
A0A3Q3NFM4_BCL2L1-      ESQGGWDCFAEIFG-RDAAAEARRSQETLRRWLLVGVALLTGVLIGVLIA
                         .:..*: * ::            :          .      :       

A0A3Q3M6G2_MCL1-02      ------------
A0A3Q3M6G2_MCL1-01      TSQSAISAPVSA
A0A3Q3KZW1_BCL2L10      LLVR--------
A0A3Q3MEY1_BCL2-01      QK----------
A0A3Q3MX20_BCL2L1-      QKRL--------
A0A3Q3NFM4_BCL2L1-      KKQ---------
A0A3Q3NFM4_BCL2L1-      KKQ---------
                                    

© 1998-2019