Dataset for protein Bcl-xL of organism Mastacembelus armatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3MX20_BCL2L1-      -MSQNRELVVFYIKYKLSQRNYPLIYIELNEQQNRTDGGEAESGEEQRIA
A0A3Q3NFM4_BCL2L1-      MSYSNRELVEFFISYKLSQKNYPTSLLRPEDAGGRTEGDMTGAAATNGLL
A0A3Q3NFM4_BCL2L1-      MSYSNRELVEFFISYKLSQKNYPTSLLRPEDAGGRTEGDMTGAAATNGLL
                           .***** *:*.*****.***   :  ::  .**:*. : :.  : : 

A0A3Q3MX20_BCL2L1-      THANGTFNGTSPGTPPASPLRQEHLQSTASLDAVKEALRDSANEFELRYA
A0A3Q3NFM4_BCL2L1-      --VNSRYVSGRPGMSSS---------PHGGVEAVKAALRDSAEEFELLFT
A0A3Q3NFM4_BCL2L1-      --VNSRYVSGRPGMSSS---------PHGGVEAVKAALRDSAEEFELLFT
                          .*. : .  ** ..:         . ..::*** ******:**** ::

A0A3Q3MX20_BCL2L1-      RAFSDLHNQLHITPATAYQSFESVMDEVFRDGVNWGRIIGLFAFGGALCV
A0A3Q3NFM4_BCL2L1-      QAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCV
A0A3Q3NFM4_BCL2L1-      QAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCV
                        .***** .** *** ***:**:*******.********:*******.***

A0A3Q3MX20_BCL2L1-      ECVEKEMSPLVGRIVEWMTLYLDNHIEPWIQSQGGWEHFAEIFGQDAAAE
A0A3Q3NFM4_BCL2L1-      ECIEKNMSALVSRIADWMTMYLDEHISPWIESQGGWDCFAEIFGRDAAAE
A0A3Q3NFM4_BCL2L1-      ECIEKNMSALVSRIADWMTMYLDEHISPWIESQGGWDCFAEIFGRDAAAE
                        **:**:**.**.**.:***:***:**.***:*****: ******.*****

A0A3Q3MX20_BCL2L1-      SRRSQENFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A3Q3NFM4_BCL2L1-      ARRSQETLRRWLLVGVALLTGVLIGVLIAKKQ-
A0A3Q3NFM4_BCL2L1-      ARRSQETLRRWLLVGVALLTGVLIGVLIAKKQ-
                        :*****.:..***.*::*:***::* ***:*. 

© 1998-2019