Dataset for protein BCL-2-like of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSC7_MCL1-03      ---------MFGLKRNAVIGLNLYC-------------------GGAGLG
A0A2K6AI30_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQ-------------------KGYVCG
A0A2K5YR37_BCL2L1-      --MSQSN----RELVVDFLSY--KL-------------------SQKGYS
A0A2K6AD55_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQI-------------------PQPGSG
A0A2K6AD55_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQI-------------------PQPGSG
A0A2K5XRD4_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRG------YEW--------DAGDVG
A0A2K5YR37_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKG------YSWSQFSDVEENRTEAP
A0A2K6AI30_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------YV---------CGAGPG
A0A2K5XSC7_MCL1-02      -------------------MFGLKRNAVIGLNLYC---------GGAGLG
A0A2K5XSC7_MCL1-01      -------------------MFGLKRNAVIGLNLYC---------GGAGLG
                                                                          

A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSC7_MCL1-03      AGSGGATPPGGRLLATGAKDTKPMGRSGATSRK-----------------
A0A2K6AI30_BCL2L2-      AGPG----------------------EGPAADP-----------------
A0A2K5YR37_BCL2L1-      WSQ-----------------------FSDVEEN-----------------
A0A2K6AD55_BCL2A1-      PSK-----------------------TSRVLQK-----------------
A0A2K6AD55_BCL2A1-      PSK-----------------------TSRVLQK-----------------
A0A2K5XRD4_BCL2-01      AATPGVAPAPGIFSSQPG-HTPHPAASRDPVARTSPLPTPAAPAAAAGPA
A0A2K5YR37_BCL2L1-      EGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA---
A0A2K6AI30_BCL2L2-      EGP-AADP------------------------------------------
A0A2K5XSC7_MCL1-02      AGSGGATP------------------------------------------
A0A2K5XSC7_MCL1-01      AGSGGATP------------------------------------------
                                                                          

A0A2K5YR37_BCL2L1-      ----------MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQS-FEQVV
A0A2K5XSC7_MCL1-03      -------ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRVM
A0A2K6AI30_BCL2L2-      -------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQVS
A0A2K5YR37_BCL2L1-      -------RTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLD
A0A2K6AD55_BCL2A1-      --------------VAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVM
A0A2K6AD55_BCL2A1-      --------------VAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVM
A0A2K5XRD4_BCL2-01      LSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATVV
A0A2K5YR37_BCL2L1-      -------VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQVV
A0A2K6AI30_BCL2L2-      -------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQVS
A0A2K5XSC7_MCL1-02      -------PGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPA-ALTPD
A0A2K5XSC7_MCL1-01      -------PGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPA-ALTPD
                                      .    .             :                

A0A2K5YR37_BCL2L1-      NELFRDG-VNWGRIVA--------FFSFGGALCV-----ESVDKEMQVLV
A0A2K5XSC7_MCL1-03      VHVFSDGVTNWGRIVT--------LISFGAFVAK-----HLKTINQESCI
A0A2K6AI30_BCL2L2-      DELFQGG-PNWGRLVA--------FFVFGAALCA-----ESVNKEMEPLV
A0A2K5YR37_BCL2L1-      ARE----------VIP--------MAAVKQALREAGDEFELRYRRAFSDL
A0A2K6AD55_BCL2A1-      EKEFEDGIINWGRIVT--------IFAFEGILIK-----KLLRQRIAPDV
A0A2K6AD55_BCL2A1-      EKEFEDGIINWGRIVT--------IFAFEGILIK-----KLLRQRIAPDV
A0A2K5XRD4_BCL2-01      EELFRDG-VNWGRIVA--------FFEFGGVMCV-----ESVNREMSPLV
A0A2K5YR37_BCL2L1-      NELFRDG-VNWGRIVA--------FFSFGGALCV-----ESVDKEMQVLV
A0A2K6AI30_BCL2L2-      DELFQGG-PNWGRLVA--------FFVFGAALCA-----ESVNKEMEPLV
A0A2K5XSC7_MCL1-02      ARRVARP-PPIGAEVPDVTATPARLFFFAPTRRA-----APLEE------
A0A2K5XSC7_MCL1-01      ARRVARP-PPIGAEVPDVTATPARLFFFAPTRRA-----APLEE------
                                      :.        :  .                      

A0A2K5YR37_BCL2L1-      SRIA--------------AWMATYLNDHLEPWIQEN----GGWD------
A0A2K5XSC7_MCL1-03      EPLA--------------ESITDVLVRTKRDWLVKQ----RGWD------
A0A2K6AI30_BCL2L2-      GQVQ--------------EWMVAYLETRLADWIHSS----GGWA------
A0A2K5YR37_BCL2L1-      TSQLHITPGTAYQSFEQDTFVELYGNNAAAESRKGQ----ERFN------
A0A2K6AD55_BCL2A1-      DTYKEIS-----------YFVAEFIMNNTGEWIRQN----GGWG------
A0A2K6AD55_BCL2A1-      DTYKEIS-----------YFVAEFIMNNTGEWIRQN----GGWE------
A0A2K5XRD4_BCL2-01      DNIA--------------LWMTEYLNRHLHTWIQDN----GGWD------
A0A2K5YR37_BCL2L1-      SRIA--------------AWMATYLNDHLEPWIQEN----GGWD------
A0A2K6AI30_BCL2L2-      GQVQ--------------EWMVAYLETRLADWIHSS----GGWELEAIKA
A0A2K5XSC7_MCL1-02      ------------------------MEAPAADAIMSPEEELDGYEPEPLGK
A0A2K5XSC7_MCL1-01      ------------------------MEAPAADAIMSPEEELDGYEPEPLGK
                                                                  :       

A0A2K5YR37_BCL2L1-      ----------TFVELYGN--------------------------------
A0A2K5XSC7_MCL1-03      ----------GFVEFFHV--------------------------------
A0A2K6AI30_BCL2L2-      ----------EFTALYGD--------------------------------
A0A2K5YR37_BCL2L1-      ----------R---------------------------------------
A0A2K6AD55_BCL2A1-      ----------K---------------------------------------
A0A2K6AD55_BCL2A1-      ----------NGFVKKFE--------------------------------
A0A2K5XRD4_BCL2-01      ----------AFVELYGP--------------------------------
A0A2K5YR37_BCL2L1-      ----------TFVELYGN--------------------------------
A0A2K6AI30_BCL2L2-      RVREMEEEAEKLKELQNE------VEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5XSC7_MCL1-02      RPAVL-----PLLELVGESGNSPSTDGSLPSTPPPAEEE------EDELY
A0A2K5XSC7_MCL1-01      RPAVL-----PLLELVGESGNSPSTDGSLPSTPPPAEEE------EDELY
                                                                          

A0A2K5YR37_BCL2L1-      ------------NAAAESRKGQERFNRWFLTGMTVA--------------
A0A2K5XSC7_MCL1-03      ---------------EDL-------EGGIRNVLLAFA-------------
A0A2K6AI30_BCL2L2-      ---------------GALEEARRLREGNWASVRTVLT-------------
A0A2K5YR37_BCL2L1-      ----------------------------WFLTGMTVA-------------
A0A2K6AD55_BCL2A1-      ----------------------------WHNHMPM---------------
A0A2K6AD55_BCL2A1-      ---------------P---------KSGWMTFLEVTG-------------
A0A2K5XRD4_BCL2-01      ------------SM-------RPLFDFSWLSLKTLLSLALVG--------
A0A2K5YR37_BCL2L1-      ------------NAAAESRKGQERFN------RWFLTGMTVA--------
A0A2K6AI30_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
A0A2K5XSC7_MCL1-02      RQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVG--------
A0A2K5XSC7_MCL1-01      RQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVG--------
                                                                          

A0A2K5YR37_BCL2L1-      --------------GVVLLGSLFSRK------------------------
A0A2K5XSC7_MCL1-03      --------------GVAGVGA----G------------------------
A0A2K6AI30_BCL2L2-      --------------GAVALGALVTVG------------------------
A0A2K5YR37_BCL2L1-      --------------GVVLLGSLFSRK------------------------
A0A2K6AD55_BCL2A1-      ---------------LVESVAHRKKK------------------------
A0A2K6AD55_BCL2A1-      --------------KICEMLSLLKQY------------------------
A0A2K5XRD4_BCL2-01      --------------ACITLGAYLGHK------------------------
A0A2K5YR37_BCL2L1-      --------------GVVLLGSLFSRK------------------------
A0A2K6AI30_BCL2L2-      EFSDKESVRTSLALDESLFRGRQIKV------IPKRTNRPGISTTDRGFP
A0A2K5XSC7_MCL1-02      -----DGVQRN---HETAFQGWVCGV-----------------LPCRGPR
A0A2K5XSC7_MCL1-01      -----DGVQRN---HETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVT
                                            .                             

A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSC7_MCL1-03      --------------------------------------------------
A0A2K6AI30_BCL2L2-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A2K6AD55_BCL2A1-      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6AI30_BCL2L2-      RARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARA------TSWYSPY
A0A2K5XSC7_MCL1-02      RW---------------------HQKCAAGFCRCCWS------RSWF---
A0A2K5XSC7_MCL1-01      NWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQ
                                                                          

A0A2K5YR37_BCL2L1-      -----------------------------------------
A0A2K5XSC7_MCL1-03      -----------------------------------LAYLIR
A0A2K6AI30_BCL2L2-      -----------------------------------AFFASK
A0A2K5YR37_BCL2L1-      -----------------------------------------
A0A2K6AD55_BCL2A1-      -----------------------------------MAL---
A0A2K6AD55_BCL2A1-      -----------------------------------C-----
A0A2K5XRD4_BCL2-01      -----------------------------------------
A0A2K5YR37_BCL2L1-      -----------------------------------------
A0A2K6AI30_BCL2L2-      -----------------------------------------
A0A2K5XSC7_MCL1-02      ------------------------------GISNKIALL--
A0A2K5XSC7_MCL1-01      RGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                                                                 

© 1998-2019