Dataset for protein Bcl-xL of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
A0A2K5YR37_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
                                                                          

A0A2K5YR37_BCL2L1-      -----MWKRTGLRPQKG-----------------------------LNRR
A0A2K5YR37_BCL2L1-      INGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A2K5YR37_BCL2L1-      INGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                              *: ..  . :*                             :: *

A0A2K5YR37_BCL2L1-      WRPPVPSMATH----PGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A2K5YR37_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A2K5YR37_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQ-------------------------
                        :* ....::::    **********                         

A0A2K5YR37_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A2K5YR37_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A2K5YR37_BCL2L1-      --------------------------------------DTFVELYGNNAA
                                                              ************

A0A2K5YR37_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A2K5YR37_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A2K5YR37_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                        *********************************

© 1998-2019