Dataset for protein BCL-2-like of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6DS80_BCL2A1-      MTDC--------------EFGYIYRLAQDYLQYVL---------------
A0A2K6DS80_BCL2A1-      MTDC--------------EFGYIYRLAQDYLQYVL---------------
A0A2K6CIX3_BCL2-01      MAHAG-------------RTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA
A0A2K6EA73_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKG------YVC---------GAGPGE
A0A2K6ECR0_MCL1-02      ------------------MFGLKRNAVIGLNLYCG---------GAGLGA
A0A2K6ECR0_MCL1-01      ------------------MFGLKRNAVIGLNLYCG---------GAGLGA
A0A2K6EA73_BCL2L2-      MATP--------------ASAPDTRALVADFVGYK---------LRQKGY
A0A2K6B2D9_BCL2L10      -MAD--------------PLRERTERLLADYLGCC---------AR----
A0A2K6ECR0_MCL1-03      ------------------MFGLKRNAVIGLNLYCG---------GAGLGA
                                                                          

A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6CIX3_BCL2-01      ATPGAAPAPGIFSSQ-----------------------------------
A0A2K6EA73_BCL2L2-      GP-AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSD
A0A2K6ECR0_MCL1-02      GSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPP-------
A0A2K6ECR0_MCL1-01      GSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPP-------
A0A2K6EA73_BCL2L2-      VCGA---------GP-----------------------------------
A0A2K6B2D9_BCL2L10      -------------EP-----------------------------------
A0A2K6ECR0_MCL1-03      GSGGATPPGGRLLAT-----------------------------------
                                                                          

A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K6EA73_BCL2L2-      ELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRL
A0A2K6ECR0_MCL1-02      -------------------AALTPDARRVARPPPIG-----------AEV
A0A2K6ECR0_MCL1-01      -------------------AALTPDARRVARPPPIG-----------AEV
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6CIX3_BCL2-01      ----------------------------------------PGHTPHPAAS
A0A2K6EA73_BCL2L2-      ADWIHSSGGWELEAIKARVREMEE-EAEKLKELQNEVEKQMNMSPPPGNA
A0A2K6ECR0_MCL1-02      PDVTASPARLLFFAPTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLGK
A0A2K6ECR0_MCL1-01      PDVTASPARLLFFAPTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLGK
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6DS80_BCL2A1-      --------------------------------------------------
A0A2K6CIX3_BCL2-01      RDPVARTSPLPTPAAPAAAAGPALSPVPPV--------------------
A0A2K6EA73_BCL2L2-      GPVIMSIEEKMEADARSIYVGNV--DYGATAEELEAHFHGCGSVNRVTIL
A0A2K6ECR0_MCL1-02      RPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYR----QSLEII
A0A2K6ECR0_MCL1-01      RPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYR----QSLEII
A0A2K6EA73_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6DS80_BCL2A1-      ---------------QIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCL
A0A2K6DS80_BCL2A1-      ---------------QIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCL
A0A2K6CIX3_BCL2-01      --------------------------VHLTLRQAGDDFSRRYRRDFAEMS
A0A2K6EA73_BCL2L2-      CDKFSGHPKGFAYIEFSDKESVRTSLALD-------------ESLFRGRQ
A0A2K6ECR0_MCL1-02      SRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWV
A0A2K6ECR0_MCL1-01      SRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGML
A0A2K6EA73_BCL2L2-      ---------G---------EGPAADPLHQAMRAAGDEFETRFRRTFSDLA
A0A2K6B2D9_BCL2L10      ---------GTPEPRPSTPEAAVLRSAAARLRQ----LHRSFFSAYRGY-
A0A2K6ECR0_MCL1-03      ---------GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGML
                                                                          

A0A2K6DS80_BCL2A1-      DNVNVASIDTARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKKLLR
A0A2K6DS80_BCL2A1-      DNVNVASIDTARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKKLLR
A0A2K6CIX3_BCL2-01      SQLHLTPFTARGR-FATVVEELFRDG--VNWGRIVAFFEFGGVMCVE---
A0A2K6EA73_BCL2L2-      IKV------IPKR-TNRPGISTTDRGF-PRARYRARTTNYNSSRSRFYSG
A0A2K6ECR0_MCL1-02      CGV------------------LPCRGP-RRW-------------------
A0A2K6ECR0_MCL1-01      RKLDIKNEDDVKS-LSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKT
A0A2K6EA73_BCL2L2-      AQLHVTPGSAQQR-FTQVSDELFQGG--PNWGRLVAFFVFGAALCAE---
A0A2K6B2D9_BCL2L10      ------PGNRVEL-VALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPL
A0A2K6ECR0_MCL1-03      RKLDIKNEDDVKS-LSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKT
                                                 .                        

A0A2K6DS80_BCL2A1-      Q------------------RIAPDVDTYKE-ISYFVAEFIMNNTGEWIRQ
A0A2K6DS80_BCL2A1-      Q------------------RIAPDVDTYKE-ISYFVAEFIMNNTGEWIRQ
A0A2K6CIX3_BCL2-01      -------------------SVNREMSPLVDNIALWMTEYLNRHLHTWIQD
A0A2K6EA73_BCL2L2-      F------------------NSRPRGRVYRGRARA----------TSWYSP
A0A2K6ECR0_MCL1-02      --------------------HQKCAAGFCRCCWS----------RSWF--
A0A2K6ECR0_MCL1-01      I------------------NQESCIEPLAESITDVLVR----TKRDWLVK
A0A2K6EA73_BCL2L2-      -------------------SVNKEMEPLVGQVQEWMVAYLETRLADWIHS
A0A2K6B2D9_BCL2L10      VTAWWKKRGFQPRLKEQEGDVARDCQRLVALLSSRLAG----QHRAWLQA
A0A2K6ECR0_MCL1-03      I------------------NQESCIEPLAESITDVLVR----TKRDWLVK
                                                                      *   

A0A2K6DS80_BCL2A1-      NGGWENGFVKK----------------FEPKSGWMTFLEVTGKICEMLSL
A0A2K6DS80_BCL2A1-      NGGWGK---------------------------WHNHMPM---LVESVAH
A0A2K6CIX3_BCL2-01      NGGWDAFVELYGPSMRPLFDFS-----WLSLKTLLSLALVGACITLGAYL
A0A2K6EA73_BCL2L2-      Y-------------------------------------------------
A0A2K6ECR0_MCL1-02      -----------------------------------------GISNKIALL
A0A2K6ECR0_MCL1-01      QRGWDGFVEFFHVEDLE----------GGIRNVLLAFAGVAGVGAGLAYL
A0A2K6EA73_BCL2L2-      SGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFF
A0A2K6B2D9_BCL2L10      QGGWDGFCHFFRSPFPL----------AFWRKLLIQAFLACLLATAFGYL
A0A2K6ECR0_MCL1-03      QRGWDGFVEFFHVEDLE----------GGIRNVLLAFAGVAGVGAGLAYL
                                                                          

A0A2K6DS80_BCL2A1-      LKQYC--
A0A2K6DS80_BCL2A1-      KKKKMAL
A0A2K6CIX3_BCL2-01      GHK----
A0A2K6EA73_BCL2L2-      -------
A0A2K6ECR0_MCL1-02      -------
A0A2K6ECR0_MCL1-01      IR-----
A0A2K6EA73_BCL2L2-      ASK----
A0A2K6B2D9_BCL2L10      WTRLL--
A0A2K6ECR0_MCL1-03      IR-----
                               

© 1998-2019