Dataset for protein BCL-2-like of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1D5QRF2_BCL2-01      -------------------------MAHAGRTGYDNREIVMKYIHYKLS-
F6UKR4_BCL2L1-02        --------------------------------------------------
F6UKR4_BCL2L1-01        -------------------------------MSQSNRELVVDFLSYKLS-
F7E8V5_BCL2A1-02        ---------------------------MTDCEFGYIYRLAQDYLQYVLQI
F7E8V5_BCL2A1-01        ---------------------------MTDCEFGYIYRLAQDYLQYVLQI
F7G4L5_BCL2L2-04        ---MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLR-
F7H6U5_BCL2L10-01       MADPLRERTERLLADYLGCCAR-----------------EP---------
F7HUE9_MCL1-02          ---MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAT---------
F7G4L5_BCL2L2-02        --------------------------MATPASAPDTRALVADFVGYKLR-
F7G4L5_BCL2L2-03        --------------------------MATPASAPDTRALVADFVGYKLR-
F7G4L5_BCL2L2-05        --------------------------MATPASAPDTRALVADFVGYKLR-
F7HUE9_MCL1-01          ---MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARRE
                                                                          

A0A1D5QRF2_BCL2-01      ----QRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTS
F6UKR4_BCL2L1-02        --------------------------------------------MWKRTG
F6UKR4_BCL2L1-01        ----QKGYSWSQFSDVEENRTEAPEG---TESEMETPSAINGNPSWHLVD
F7E8V5_BCL2A1-02        --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
F7G4L5_BCL2L2-04        ----QKGYVCGAGPG-----------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
F7G4L5_BCL2L2-02        ----QKGYVCGAGPG-----------------------------------
F7G4L5_BCL2L2-03        ----QKGYVCGAGPG-----------------------------------
F7G4L5_BCL2L2-05        ----QKGYVCGAGPG-----------------------------------
F7HUE9_MCL1-01          IGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTASPARLL
                                                                          

A0A1D5QRF2_BCL2-01      PLPTPAAPAAAAAAGPALSPVP----------------------------
F6UKR4_BCL2L1-02        LRPQKG--------------------------------------------
F6UKR4_BCL2L1-01        SPAVNGATGHSSSLDAREVIPM----------------------------
F7E8V5_BCL2A1-02        --------------PQPGSGPS----------------------------
F7E8V5_BCL2A1-01        --------------PQPGSGPS----------------------------
F7G4L5_BCL2L2-04        --------------EGPAADPL----------------------------
F7H6U5_BCL2L10-01       --------------GTPEPRPS----------------------------
F7HUE9_MCL1-02          --------------GAKDTKPM----------------------------
F7G4L5_BCL2L2-02        --------------EGPAADPL----------------------------
F7G4L5_BCL2L2-03        --------------EGPAADPL----------------------------
F7G4L5_BCL2L2-05        --------------EGPAADPL----------------------------
F7HUE9_MCL1-01          FFAPTRRASPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELV
                                                                          

A0A1D5QRF2_BCL2-01      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
F6UKR4_BCL2L1-01        --------------------------------------------------
F7E8V5_BCL2A1-02        --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
F7G4L5_BCL2L2-04        --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
F7G4L5_BCL2L2-05        --------------------------------------------------
F7HUE9_MCL1-01          GESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTK
                                                                          

A0A1D5QRF2_BCL2-01      ---------PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRF
F6UKR4_BCL2L1-02        ----------------------LNRRWRPPVPSMATH----P-GTAYQSF
F6UKR4_BCL2L1-01        ---------AAVKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSF
F7E8V5_BCL2A1-02        ----------KTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLF
F7E8V5_BCL2A1-01        ----------KTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLF
F7G4L5_BCL2L2-04        ------------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRF
F7H6U5_BCL2L10-01       --TPEAAVLRSAAARLRQ----LHRSFFSAYRGY-------P-GNRVELV
F7HUE9_MCL1-02          --GRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSL
F7G4L5_BCL2L2-02        ------------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRF
F7G4L5_BCL2L2-03        ------------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRF
F7G4L5_BCL2L2-05        ------------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRF
F7HUE9_MCL1-01          PMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSL
                                              .                          .

A0A1D5QRF2_BCL2-01      ATVVEELFRDG--VNWGRIVAFFEFGGVMCVESVNR--------------
F6UKR4_BCL2L1-02        EQVVNELFRDG--VNWGRIVAFFSFGGALCVESVDK--------------
F6UKR4_BCL2L1-01        EQVVNELFRDG--VNWGRIVAFFSFGGALCVESVDK--------------
F7E8V5_BCL2A1-02        NQVMEKEFEDGI-INWGRIVTIFAFEGILIKKLLRQ--------------
F7E8V5_BCL2A1-01        NQVMEKEFEDGI-INWGRIVTIFAFEGILIKKLLRQ--------------
F7G4L5_BCL2L2-04        TQVSDELFQGG--PNWGRLVAFFVFGAALCAESVNK--------------
F7H6U5_BCL2L10-01       ALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRGFQPRLK
F7HUE9_MCL1-02          SRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTI--------------
F7G4L5_BCL2L2-02        TQVSDELFQGG--PNWGRLVAFFVFGAALCAESVNK--------------
F7G4L5_BCL2L2-03        TQVSDELFQGG--PNWGRLVAFFVFGAALCAESVNK--------------
F7G4L5_BCL2L2-05        TQVSDELFQGG--PNWGRLVAFFVFGAALCAESVNK--------------
F7HUE9_MCL1-01          SRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTI--------------
                          :    : ..   .***:*::. * . :                     

A0A1D5QRF2_BCL2-01      ----EMSPLVDNIAL---WMTEYLNRHLHTWIQDNGGW------------
F6UKR4_BCL2L1-02        ----EMQVLVSRIAA---WMATYLNDHLEPWIQENGGW------------
F6UKR4_BCL2L1-01        ----EMQVLVSRIAA---WMATYLNDHLEPWIQENGGW------------
F7E8V5_BCL2A1-02        ----RIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW------------
F7E8V5_BCL2A1-01        ----RIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW------------
F7G4L5_BCL2L2-04        ----EMEPLVGQVQE---WMVAYLETRLADWIHSSGGWLSQITEAEMADE
F7H6U5_BCL2L10-01       EQEGDVARDCQRLVA---LLSSRLAGQHRAWLQAQGGW------------
F7HUE9_MCL1-02          ----NQESCIEPLAE---SITDVLVRTKRDWLVKQRGW------------
F7G4L5_BCL2L2-02        ----EMEPLVGQVQE---WMVAYLETRLADWIHSSGGW------------
F7G4L5_BCL2L2-03        ----EMEPLVGQVQE---WMVAYLETRLADWIHSSGGW------------
F7G4L5_BCL2L2-05        ----EMEPLVGQVQE---WMVAYLETRLADWIHSSGGW------------
F7HUE9_MCL1-01          ----NQESCIEPLAE---SITDVLVRTKRDWLVKQRGW------------
                                           :   :      *:  . **            

A0A1D5QRF2_BCL2-01      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
F6UKR4_BCL2L1-01        --------------------------------------------------
F7E8V5_BCL2A1-02        --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
F7G4L5_BCL2L2-04        VICSEILSDCDSAPSSPDLEELEAIKARVREMEEEAEKLKELQNEVEKQM
F7H6U5_BCL2L10-01       --------------------D-----------------------------
F7HUE9_MCL1-02          --------------------D-----------------------------
F7G4L5_BCL2L2-02        --------------------A-----------------------------
F7G4L5_BCL2L2-03        --------------------A-----------------------------
F7G4L5_BCL2L2-05        --------------------ELEAIKARVREMEEEAEKLKELQNEVEKQM
F7HUE9_MCL1-01          --------------------D-----------------------------
                                                                          

A0A1D5QRF2_BCL2-01      -------------------------VGALGDVSLGWGHRFEVRGLECGWA
F6UKR4_BCL2L1-02        ----------------------DTFVELYGNNA----------------A
F6UKR4_BCL2L1-01        ----------------------DTFVELYGNNA----------------A
F7E8V5_BCL2A1-02        --------------------------------------------------
F7E8V5_BCL2A1-01        ---------------------------ENGF------------------V
F7G4L5_BCL2L2-04        NMSPPPGNAGPVIMSIEEKMEADARSIYVGN------------------V
F7H6U5_BCL2L10-01       -----------------------------GF------------------C
F7HUE9_MCL1-02          -----------------------------GF------------------V
F7G4L5_BCL2L2-02        -----------------------EFTALYGD------------------G
F7G4L5_BCL2L2-03        -----------------------EFTALYGD------------------G
F7G4L5_BCL2L2-05        NMSPPPGNAGPVIMSIEEKMEADARSIYVGN------------------V
F7HUE9_MCL1-01          -----------------------------GF------------------V
                                                                          

A0A1D5QRF2_BCL2-01      PGARGGCG-------AGEIKSGLLLPGVPTSSSG----------------
F6UKR4_BCL2L1-02        AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK-----------------
F6UKR4_BCL2L1-01        AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK-----------------
F7E8V5_BCL2A1-02        ----------------GKWHNHMPMLVESVAH------------------
F7E8V5_BCL2A1-01        KKFEPKSGWMTFLEVTGKICEMLSLLKQYC--------------------
F7G4L5_BCL2L2-04        DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTS
F7H6U5_BCL2L10-01       HFFRSPFPL-------AFWRKLLIQAFLACLLATAFGYL-----------
F7HUE9_MCL1-02          EFFHVEDLE-------GGIRNVLLAFAGVAGVGAGLAYL-----------
F7G4L5_BCL2L2-02        ALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK-----------
F7G4L5_BCL2L2-03        ALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK-----------
F7G4L5_BCL2L2-05        DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTS
F7HUE9_MCL1-01          EF-FHVEDLE------GGIRNVLLAFAGVAGVGAGLAYL-------IR--
                                                                          

A0A1D5QRF2_BCL2-01      --------------------------------------------------
F6UKR4_BCL2L1-02        --------------------------------------------------
F6UKR4_BCL2L1-01        --------------------------------------------------
F7E8V5_BCL2A1-02        --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
F7G4L5_BCL2L2-04        LALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSR
F7H6U5_BCL2L10-01       --------------------------------------------------
F7HUE9_MCL1-02          --------------------------------------------------
F7G4L5_BCL2L2-02        --------------------------------------------------
F7G4L5_BCL2L2-03        --------------------------------------------------
F7G4L5_BCL2L2-05        LALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSR
F7HUE9_MCL1-01          --------------------------------------------------
                                                                          

A0A1D5QRF2_BCL2-01      ---------------------------
F6UKR4_BCL2L1-02        ---------------------------
F6UKR4_BCL2L1-01        ---------------------------
F7E8V5_BCL2A1-02        ---------------------------
F7E8V5_BCL2A1-01        ---------------------------
F7G4L5_BCL2L2-04        FYSGFNSRPRGRVYRGRARATSWYSPY
F7H6U5_BCL2L10-01       ----------------------WTRLL
F7HUE9_MCL1-02          ----------------------IR---
F7G4L5_BCL2L2-02        ---------------------------
F7G4L5_BCL2L2-03        ---------------------------
F7G4L5_BCL2L2-05        FYSGFNSRPRGRVYRGRARATSWYSPY
F7HUE9_MCL1-01          ---------------------------
                                                   

© 1998-2019