Dataset for protein Bcl-w of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7G4L5_BCL2L2-04      MPLLILSPYIHASVSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
F7G4L5_BCL2L2-02      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
F7G4L5_BCL2L2-03      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
F7G4L5_BCL2L2-05      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
                                             ***************************

F7G4L5_BCL2L2-04      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
F7G4L5_BCL2L2-02      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
F7G4L5_BCL2L2-03      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
F7G4L5_BCL2L2-05      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
                      **************************************************

F7G4L5_BCL2L2-04      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
F7G4L5_BCL2L2-02      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
F7G4L5_BCL2L2-03      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
F7G4L5_BCL2L2-05      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
                      **************************************************

F7G4L5_BCL2L2-04      AYLETRLADWIHSSGGWLSQITEAEMADEVICSEILSDCDSAPSSPDLEE
F7G4L5_BCL2L2-02      AYLETRLADWIHSSGGW--------------------------------A
F7G4L5_BCL2L2-03      AYLETRLADWIHSSGGW--------------------------------A
F7G4L5_BCL2L2-05      AYLETRLADWIHSSGGW--------------------------------E
                      *****************                                 

F7G4L5_BCL2L2-04      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
F7G4L5_BCL2L2-02      -EFTALYGDGALEEARRLRE---------------GNWASV---------
F7G4L5_BCL2L2-03      -EFTALYGDGALEEARRLRE---------------GNWASV---------
F7G4L5_BCL2L2-05      LEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
                       *          *** .*.*               ** ..*         

F7G4L5_BCL2L2-04      ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
F7G4L5_BCL2L2-02      ---RTVLTGAVALGALVT--------------------------------
F7G4L5_BCL2L2-03      ---RTVLTGAVALGALVT--------------------------------
F7G4L5_BCL2L2-05      ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
                         *:: .* *  ** .                                 

F7G4L5_BCL2L2-04      EFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRA
F7G4L5_BCL2L2-02      --------------------------------------------------
F7G4L5_BCL2L2-03      --------------------------------------------------
F7G4L5_BCL2L2-05      EFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRA
                                                                        

F7G4L5_BCL2L2-04      RTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
F7G4L5_BCL2L2-02      ------------------------------VGAFFASK
F7G4L5_BCL2L2-03      ------------------------------VGAFFASK
F7G4L5_BCL2L2-05      RTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                                                    . ::::. 

© 1998-2019