Dataset for protein Bcl-xL of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6UKR4_BCL2L1-02      --------------------------------------------------
F6UKR4_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
                                                                        

F6UKR4_BCL2L1-02      -----MWKRTGLRPQKG-----------------------------LNRR
F6UKR4_BCL2L1-01      INGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                            *: ..  . :*                             :: *

F6UKR4_BCL2L1-02      WRPPVPSMATH----PGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
F6UKR4_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                      :* ....::::    ***********************************

F6UKR4_BCL2L1-02      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
F6UKR4_BCL2L1-01      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                      **************************************************

F6UKR4_BCL2L1-02      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
F6UKR4_BCL2L1-01      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                      *********************************

© 1998-2019