Dataset for protein Bfl1 of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7E8V5_BCL2A1-02      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEK
F7E8V5_BCL2A1-01      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEK
                      **************************************************

F7E8V5_BCL2A1-02      NLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
F7E8V5_BCL2A1-01      NLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
                      **************************************************

F7E8V5_BCL2A1-02      KKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW----------
F7E8V5_BCL2A1-01      KKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
                      ****************************************          

F7E8V5_BCL2A1-02      -----------GKWHNHMPMLVESVAH
F7E8V5_BCL2A1-01      KSGWMTFLEVTGKICEMLSLLKQYC--
                                 **  : :.:* :    

© 1998-2019