Dataset for protein BCL-2-like of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------YVCGAGPGEGPA-ADPL
A0A2K5W0W9_MCL1-01      -------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPP
A0A2K5W0W9_MCL1-02      -------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPP
I7G687_MCL1-01          -------------------MFGLKRNAVIGLNLYCGGAGLGAGSSGATPP
A0A2K5V0Q3_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY----------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5UDI5_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFS
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE----G
Q2PFS6_BCL2L1-01        --------------------------------------------------
A0A2K5TKG9_BCL2L10      -------------------------------------MADPLRERTERLL
A0A2K5W0W9_MCL1-03      ----------------------------------------MFGLKRNAVI
                                                                          

A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPN
A0A2K5W0W9_MCL1-01      GGRLLATEKEASARREIGGGEAGTVIGGSAGASPP---------------
A0A2K5W0W9_MCL1-02      GGRLLATEKEASARREIGGGEAGTVIGGSAGASPP---------------
I7G687_MCL1-01          GGRLLATEKEASARREIGGGEAGTVIGGSAGASPP---------------
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5UDI5_BCL2-01      SQPGHTPHPA----------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      TESEMETPSA----------------------------------------
Q2PFS6_BCL2L1-01        ----METPSA----------------------------------------
A0A2K5TKG9_BCL2L10      ADYLGCCAR-----------------------------------------
A0A2K5W0W9_MCL1-03      GLNLYCGGAG----------------------------------------
                                                                          

A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      WGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSG
A0A2K5W0W9_MCL1-01      -----------AALTPDARRVARPPPIG-----------AEVPDVTASPA
A0A2K5W0W9_MCL1-02      -----------AALTPDARRVARPPPIG-----------AEVPDVTASPA
I7G687_MCL1-01          -----------AALTPDARRVARPPPIG-----------AEVPDVTASPA
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
I7GKS6_BCL2L1-01        ----------------MWKRTGLRPQKG----------------------
A0A2K5UDI5_BCL2-01      -----------ASRDPVARTSPLPTPAA----------------------
A0A2K5VPG2_BCL2L1-      ----------------MWKRTGLRPQKG----------------------
A0A2K5VPG2_BCL2L1-      -----------INGNPSWHLVDSPAVNG----------------------
Q2PFS6_BCL2L1-01        -----------INGNPSWHLVDSPAVNG----------------------
A0A2K5TKG9_BCL2L10      ---------------------------E----------------------
A0A2K5W0W9_MCL1-03      -----------LGAGSGGATPPGGRLLA----------------------
                                                                          

A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5TMD8_BCL2A1-      --------------------------------------------------
A0A2K5V0Q3_BCL2L2-      GWELEAIKARVREMEE-EAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIE
A0A2K5W0W9_MCL1-01      RLLFFAPTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLL
A0A2K5W0W9_MCL1-02      RLLFFAPTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLL
I7G687_MCL1-01          RLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLL
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
                                                                          

A0A2K5TMD8_BCL2A1-      ------------------------------------MTDCEFGYIYRLAQ
A0A2K5TMD8_BCL2A1-      ------------------------------------MTDCEFGYIYRLAQ
A0A2K5V0Q3_BCL2L2-      EKMEADARSIYVGNV--DYGATAEELEAHFHGCGSVNRVTILCDKFSGHP
A0A2K5W0W9_MCL1-01      ELVGESGNSPSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYLREQA
A0A2K5W0W9_MCL1-02      ELVGESGNSPSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYLREQA
I7G687_MCL1-01          ELVGESGNSPSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYLREQA
A0A2K5V0Q3_BCL2L2-      --------------------------------------------------
I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
A0A2K5VPG2_BCL2L1-      --------------------------------------------------
Q2PFS6_BCL2L1-01        --------------------------------------------------
A0A2K5TKG9_BCL2L10      --------------------------------------------------
A0A2K5W0W9_MCL1-03      --------------------------------------------------
                                                                          

A0A2K5TMD8_BCL2A1-      DYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASI
A0A2K5TMD8_BCL2A1-      DYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASI
A0A2K5V0Q3_BCL2L2-      KGFAYIEFSDKESVRTSLALD-------------ESLFRGRQIKV-----
A0A2K5W0W9_MCL1-01      TGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV-----
A0A2K5W0W9_MCL1-02      TGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-
I7G687_MCL1-01          TGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-
A0A2K5V0Q3_BCL2L2-      ----VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-
I7GKS6_BCL2L1-01        -----------------------------LNRRWRPPVPSMATH-PGTP-
A0A2K5UDI5_BCL2-01      PAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-
A0A2K5VPG2_BCL2L1-      -----------------------------LNRRWRPPVPSMATH----P-
A0A2K5VPG2_BCL2L1-      ATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-
Q2PFS6_BCL2L1-01        ATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-
A0A2K5TKG9_BCL2L10      PGTPEPRPSTPEAAVLRSAAARLRQ----LHRSFFSAYRGY-------P-
A0A2K5W0W9_MCL1-03      TGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-
                                                                          

A0A2K5TMD8_BCL2A1-      DTARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKKLLRQ-------
A0A2K5TMD8_BCL2A1-      DTARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKKLLRQ-------
A0A2K5V0Q3_BCL2L2-      --IPKRTNRPGISTTDRGF-PRARYRARTTNYNSSRSRFYSGF-------
A0A2K5W0W9_MCL1-01      -------------LPCRGP-RRW---------------------------
A0A2K5W0W9_MCL1-02      EDDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTI-------
I7G687_MCL1-01          EDDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTI-------
A0A2K5V0Q3_BCL2L2-      GSAQQRFTQVSDELFQGGP--NWGRLVAFFVFGAALCAESVNK-------
I7GKS6_BCL2L1-01        GTAYQSFEQVVNELFRDGV--NWGRIVAFFSFGGALCVESVDK-------
A0A2K5UDI5_BCL2-01      FTARGRFATVVEELFRDGV--NWGRIVAFFEFGGVMCVESVNR-------
A0A2K5VPG2_BCL2L1-      GTAYQSFEQVVNELFRDGV--NWGRIVAFFSFGGALCVESVDK-------
A0A2K5VPG2_BCL2L1-      GTAYQSFEQVVNELFRDGV--NWGRIVAFFSFGGALCVESVDK-------
Q2PFS6_BCL2L1-01        GTAYQSFEQVVNELFRDGV--NWGRIVAFFSFGGALCVESVDK-------
A0A2K5TKG9_BCL2L10      GNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKR
A0A2K5W0W9_MCL1-03      EDDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTI-------
                                         .                                

A0A2K5TMD8_BCL2A1-      -----------RIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFV
A0A2K5TMD8_BCL2A1-      -----------RIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK---
A0A2K5V0Q3_BCL2L2-      -----------NSRPRGR---VYRGRARA------TSWYSPY--------
A0A2K5W0W9_MCL1-01      ------------HQKCAA---GFCRCCWS------RSWF-----------
A0A2K5W0W9_MCL1-02      -----------NQESCIE---PLAESITDVLVRTKRDWLVKQRGWDG-FV
I7G687_MCL1-01          -----------NQESCIE---PLAESITDVLVRTKRDWLVKQRGWDG-FV
A0A2K5V0Q3_BCL2L2-      -----------EMEPLVG---QVQEWMVAYLETRLADWIHSSGGWAE-FT
I7GKS6_BCL2L1-01        -----------EMQVLVS---RIAAWMATYLNDHLEPWIQENGGWDT-FV
A0A2K5UDI5_BCL2-01      -----------EMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWDA-FV
A0A2K5VPG2_BCL2L1-      -----------EMQVLVS---RIAAWMATYLNDHLEPWIQENGGWDT-FV
A0A2K5VPG2_BCL2L1-      -----------EMQVLVS---RIAAWMATYLNDHLEPWIQENGGWDT-FV
Q2PFS6_BCL2L1-01        -----------EMQVLVS---RIAAWMATYLNDHLEPWIQENGGWDT-FV
A0A2K5TKG9_BCL2L10      GFQPRLKEQEGDVARDCQ---RLVALLSSRLAGQHRAWLQAQGGWDG-FC
A0A2K5W0W9_MCL1-03      -----------NQESCIE---PLAESITDVLVRTKRDWLVKQRGWDG-FV
                                                             *            

A0A2K5TMD8_BCL2A1-      KKFEPKS------------------GWMTFLEVTGKICEMLSLLKQYC-
A0A2K5TMD8_BCL2A1-      --------------------------WHNHMPM---LVESVAHKKKMAL
A0A2K5V0Q3_BCL2L2-      -------------------------------------------------
A0A2K5W0W9_MCL1-01      -----------------------------------GISNKIALL-----
A0A2K5W0W9_MCL1-02      EFFHVEDLEGGIR------------NVLLAFAGVAGVGAGLAYLIR---
I7G687_MCL1-01          EFFHVEDLEGGIR------------NVLLAFAGVAGVGAGLAYLIR---
A0A2K5V0Q3_BCL2L2-      ALYGDGALEEARRLRE---GNWASVRTVLTGAVALGALVTVGAFFASK-
I7GKS6_BCL2L1-01        ELYGNNAAAESRKGQERFN------RWFLTG-MTVAGVVLLGSLFSRK-
A0A2K5UDI5_BCL2-01      ELYGPSM-------RPLFDFSWLSLKTLLSL-ALVGACITLGAYLGHK-
A0A2K5VPG2_BCL2L1-      ELYGNNAAAESRKGQERFN------RWFLTG-MTVAGVVLLGSLFSRK-
A0A2K5VPG2_BCL2L1-      ELYGNNAAAESRKGQERFN------RWFLTG-MTVAGVVLLGSLFSRK-
Q2PFS6_BCL2L1-01        ELYGNNAAAESRKGQERFN------RWFLTG-MTVAGVVLLGSLFSRK-
A0A2K5TKG9_BCL2L10      HFFRSPFPLAFWR------------KLLIQAFLACLLATAFGYLWTRLL
A0A2K5W0W9_MCL1-03      EFFHVEDLEGGIR------------NVLLAFAGVAGVGAGLAYLIR---
                                                                         

© 1998-2019