Dataset for protein BCL-2-like of organism Loxodonta africana

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3T756_MCL1-01        MFGFKRNAVIGLNLYCGGAGLGAGGCATPPGGRLPAPGKEATARQEVGGG
G3T8E6_BCL2A1-01      ---------------------------------------MTDCEFGYI--
G3SPN0_BCL2L1-01      ---------------------------------------MSQ--------
G3TMU7_BCL2L2-01      ---------------------------------------YIHVSLSSLTL
G3ULB7_BCL2-01        ---------------------------------------MAHAGRTGY--
G3ULB7_BCL2-02        ---------------------------------------MAHAGRTGY--
                                                                        

G3T756_MCL1-01        DAGASPPAAVAPDGRRVVRPAPIGAEGPDVTAIPARPTFFAPTRRASPPV
G3T8E6_BCL2A1-01      --------------YKLVQD------------------------------
G3SPN0_BCL2L1-01      ------------SNRELVVD------------------------------
G3TMU7_BCL2L2-01      AAARMATPASAPDTRALVAD------------------------------
G3ULB7_BCL2-01        ------------DNREIVMK------------------------------
G3ULB7_BCL2-02        ------------DNREIVMK------------------------------
                                      :*                                

G3T756_MCL1-01        EMEALAADAIMSPEEELDGYEPEPLGKRPAVFPRLGLVGEASNGPGTDGS
G3T8E6_BCL2A1-01      -------------------YLKYVLQI-----------------------
G3SPN0_BCL2L1-01      -------------------FLSYKLSQKGYSWSQFSDVEENRTGASEGTE
G3TMU7_BCL2L2-01      -------------------FVGYKLRQKGYVCG---------AG------
G3ULB7_BCL2-01        -------------------YIHYKLSQRGYEWE---------AGEASAAP
G3ULB7_BCL2-02        -------------------YIHYKLSQRGYEWE---------AGEA----
                                         :    *                         

G3T756_MCL1-01        LPSTPPLAEEEEDELYRQSLEIISRYLQEQATGAKDTKPMGGSGAASRKA
G3T8E6_BCL2A1-01      -------------------PQPAAGSSKTSRVLQNVAFS------VQKEV
G3SPN0_BCL2L1-01      SEMEIPSAINGNPSRHLADSPAVNGATGHSSSLDAREVI------PMAAV
G3TMU7_BCL2L2-01      ----------------------------------PGEGP------AADPL
G3ULB7_BCL2-01        PGAAPAPGVLSSPPAAPRGPDTRTSPLQADPAAQPALSP------VPPVV
G3ULB7_BCL2-02        --------------------DTRTSPLQADPAAQPALSP------VPPVV
                                                                        

G3T756_MCL1-01        LETLRRVADGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMAHVFSDGIT
G3T8E6_BCL2A1-01      EKNLKPCLDNF--------------VVISIDTAQTIFKQVMEKEFEDGII
G3SPN0_BCL2L1-01      KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDG-V
G3TMU7_BCL2L2-01      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-P
G3ULB7_BCL2-01        HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG-V
G3ULB7_BCL2-02        HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG-V
                         :.   * .              : :.       :  *    * .*  

G3T756_MCL1-01        NWGRIVTLISFGAFVAKHLKSVNQESRIE---PLAESITDVLVRTKRDWL
G3T8E6_BCL2A1-01      NWGRIVTIFAFGGILIKKLLRERIAPDVDTYKKISSFVAEFIVDNTAEWI
G3SPN0_BCL2L1-01      NWGRIVAFFSFGGALCVESVDKEMQVLVS---RIATWMATYLNDHLEPWI
G3TMU7_BCL2L2-01      NWGRLVAFFVFGAALCAESVNKEMEPLVG---QVQEWMVVYLETRLADWI
G3ULB7_BCL2-01        NWGRIVAFFEFGGVMCVESVNREMSPLVD---NIALWMTEYLNRHLHTWI
G3ULB7_BCL2-02        NWGRIVAFFEFGGVMCVESVNREMSPLVD---NIALWMTEYLNRHLHTWI
                      ****:*::: **. :            :     :   :.  :      *:

G3T756_MCL1-01        VKQRGWDGFVEFFH-------VEDLEGGIRNVLLAFAGVAGVGAGLA---
G3T8E6_BCL2A1-01      RQNGGWEN----------GFVKKFEPRSGWLTFLEVTGKI-CEMLFLLKQ
G3SPN0_BCL2L1-01      QENGGWVRTTPLLC--FSTSVKEDIAYVFIQVKTYASGKL-VQCFLTLTQ
G3TMU7_BCL2L2-01      HSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGA
G3ULB7_BCL2-01        QDNGGWDAFVELYG----PNMRPLFDFSWLSLKTLLSLAL-VGACITLGA
G3ULB7_BCL2-02        QDNGGW-----------------------------------VGACVVE--
                       .. **                                       .    

G3T756_MCL1-01        -YLIR
G3T8E6_BCL2A1-01      YY---
G3SPN0_BCL2L1-01      WFTTQ
G3TMU7_BCL2L2-01      FFASK
G3ULB7_BCL2-01        YLGHK
G3ULB7_BCL2-02        -----
                           

© 1998-2019