Dataset for protein Bcl-2 of organism Loxodonta africana

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3ULB7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWEAGEASAAPPGAAPAPGVLSSPPAAPRGPD
G3ULB7_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWEAGEA------------------------D
                    ***********************************                        *

G3ULB7_BCL2-01      TRTSPLQADPAAQPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF
G3ULB7_BCL2-02      TRTSPLQADPAAQPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF
                    ************************************************************

G3ULB7_BCL2-01      ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQ
G3ULB7_BCL2-02      ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQ
                    ************************************************************

G3ULB7_BCL2-01      DNGGWDAFVELYGPNMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
G3ULB7_BCL2-02      DNGGW------------------------------VGACVVE-------
                    *****                              ****:.        

© 1998-2019