Dataset for protein BCL-2-like of organism Lepisosteus oculatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


W5MMB7_MCL1-01        MSLSSLKRTSASAVIQLYCPNATTIHPGLASLGPCPGGSAARTAVLDPML
W5MG74_BCL2L1-01      ----KMSYSNRDLVVYY---------------------------INYKLS
W5N4F7_BCL2-01        MANNEAPYDTRNIVTKY---------------------------IHHKLL
                          .    . . *                              :   : 

W5MMB7_MCL1-01        KADYAEDELDNYSAEPVATSAWIPKSPRSLPAGLKLGGHFPESGHADGSL
W5MG74_BCL2L1-01      QKNYSWDQFSLEGRTG---------GAEAVGSGSPNAEERTNGAANGGGG
W5N4F7_BCL2-01        KKGYVWES-RVSGETDPPNNGLV--GPSASGPGLQARRLQAAGAER-GAV
                      : .*  :.    .            .. :  .*       . ..   *. 

W5MMB7_MCL1-01        PSTPDTPLDCGSVPEFLSEAHGQLNAETRELIGTFLQMYTGLPHRRSRGK
W5MG74_BCL2L1-01      PVSRQ-------PPQGIEAVQG----------------------------
W5N4F7_BCL2-01        PVPRRTP-----PPDPHAALHK----------------------------
                      * .          *:     :                             

W5MMB7_MCL1-01        ALETLKRVVDSVVAKHQIAYHGMIAKLELENKGEDVSFVTGVAKSLFSDG
W5MG74_BCL2L1-01      ---ALRDSANEFELRYGRAFSDLSSQLHITPATAYQSF-EHVMDEVFRDG
W5N4F7_BCL2-01        ---VLREAGDEIERMYHRDFAEMSDQLHFTPNTARRKF-TAVVEELFRDG
                         .*.   :..   :   :  :  :* :       .*   * ..:* **

W5MMB7_MCL1-01        KTNWGRIASLVSFGAVVAKQMKDSGRESCVEAVGQAISNYLLQDQREWLL
W5MG74_BCL2L1-01      -VNWGRIVGLFAFGGALCVECVEKEMSNLVSRIAEWMTVYLDNNIQPWIQ
W5N4F7_BCL2-01        -VNWGRIVAFFEFGGTMCVESVNREMTSQVDNIANWMTEYLNGPLQNWIQ
                       .*****..:. **..:. :  :    . *. :.: :: **    . *: 

W5MMB7_MCL1-01        NNRGWDGFVEFFRVE-------DPESTIRNALMAFAGVAGLGAGLALLIR
W5MG74_BCL2L1-01      SQGGWDRFAEIFGKDAAAEYRRSQESFKKWLLAGMTLVTGLVVGSYIAKK
W5N4F7_BCL2-01        ENGGWDAFVELYGRQRGSMFSCSWPSLKTFFGLAALGAAGLTVGAYFTQK
                      .: *** *.*::  :       .  *       .   .:** .*  :  .

W5MMB7_MCL1-01        --
W5MG74_BCL2L1-01      RL
W5N4F7_BCL2-01        --
                        

© 1998-2019