Dataset for protein Mcl-1 of organism Latimeria chalumnae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H3AR18_MCL1-01      --------------MELPGDGCPQDGDMAEFRKETLKLLRSYLCEVAGCESTETAFRFGL
H3AR18_MCL1-02      GYNADGSVPPSPPTPSTPEDG---DGDMAEFRKETLKLLRSYLCEVAGCESTETAFRFGL
                                   . * **   ************************************

H3AR18_MCL1-01      DQWSGGEKPLDTLRRVGDSIIDKHRIAFNGMQQKLNIHKEDDLHIIPEIGNQIFKDGATN
H3AR18_MCL1-02      DQWSGGEKPLDTLRRVGDSIIDKHRIAFNGMQQKLNIHKEDDLHIIPEIGNQIFKDGATN
                    ************************************************************

H3AR18_MCL1-01      WGRIVSLIAFGAVVAKKLKKMNLEDSIEQLAVSITDFLVQNKGDWILKNQGWKGFVDFFH
H3AR18_MCL1-02      WGRIVSLIAFGAVVAKKLKKMNLEDSIEQLAVSITDFLVQNKGDWILKNQGWKGFVDFFH
                    ************************************************************

H3AR18_MCL1-01      VEDAEGTIKNVLMTFAGVAGLGASLVYLMR
H3AR18_MCL1-02      VEDAEGTIKNVLMTFAGVAGLGASLVYLMR
                    ******************************

© 1998-2019