Dataset for protein BCL-2-like of organism Latimeria chalumnae

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H3ANS8_BCL2L1-01      KMSFNRLLVVDHISQKLMQRGYQWREVGEQDHGGGGDRAREAQTPEEGAI
H3AR18_MCL1-02        -------------------------GYNADGSVPPSPPTPSTPEDGDGDM
H3AAS7_BCL2L2-02      --------------------------------------------------
H3AAS7_BCL2L2-01      --------------------------------------------------
H3AR18_MCL1-01        ------------------------------------MELPGDGCPQDGDM
                                                                        

H3ANS8_BCL2L1-01      PGMDPPNGSHPHAGLNGAVNGLPAGSSSRLEAQAVSGPEAVKR-------
H3AR18_MCL1-02        AEFRKETLKLLRSYLCEVAGCESTETAFRFGLDQWSGGEKPLD-------
H3AAS7_BCL2L2-02      -----------MDSLYSNRGVVEDFIYYKLGQKGYSQQGAPTDPPANPLY
H3AAS7_BCL2L2-01      -----------MDSLYSNRGVVEDFIYYKLGQKGYSQQGAPTDPPANPLY
H3AR18_MCL1-01        AEFRKETLKLLRSYLCEVAGCESTETAFRFGLDQWSGGEKPLD-------
                                    *    .        .:  .  *              

H3ANS8_BCL2L1-01      -TLREAGEEFELRYSRAFSDLSSQLHITPGTAYQSFEQVVNELFRDGV-N
H3AR18_MCL1-02        -TLRRVGDSIIDKHRIAFNGMQQKLNIHKEDDLHIIPEIGNQIFKDGATN
H3AAS7_BCL2L2-02      RAMREAGDEFEARFHRTFNSLSSHLHITPGTAYRRFAETADSLFQDGV-N
H3AAS7_BCL2L2-01      RAMREAGDEFEARFHRTFNSLSSHLHITPGTAYRRFAETADSLFQDGV-N
H3AR18_MCL1-01        -TLRRVGDSIIDKHRIAFNGMQQKLNIHKEDDLHIIPEIGNQIFKDGATN
                       ::* .*:.:  ..  :*..:..:*:*      . : :  :.:*.**. *

H3ANS8_BCL2L1-01      WGRVVAFFAFGGALCVESMDKEMSSLVERIAEWMTTYLDDNLNPWIQEQG
H3AR18_MCL1-02        WGRIVSLIAFGAVVAKKLKKMNLEDSIEQLAVSITDFLVQNKGDWILKNQ
H3AAS7_BCL2L2-02      WGRVVALFVFSAALCVESVDKEMASLVGRIIDWTVTYVESSLQDWINHSG
H3AAS7_BCL2L2-01      WGRVVALFVFSAALCVESVDKEMASLVGRIIDWTVTYVESSLQDWINHSG
H3AR18_MCL1-01        WGRIVSLIAFGAVVAKKLKKMNLEDSIEQLAVSITDFLVQNKGDWILKNQ
                      ***:*:::.*...:. :  . :: . : .:    . :: ..   **  . 

H3ANS8_BCL2L1-01      GWATIIHIDGVDAM------QRSNTRSEKLGFVGFFFSFLLRGVERNLK-
H3AR18_MCL1-02        GWKGFVDFFHVEDA-------EGTIKNVLMTFAG------VAGLGASL--
H3AAS7_BCL2L2-02      GWSAFVCLYGNGAVGGARRFQEGYWSSMKTVVTG------AVALGAVMTV
H3AAS7_BCL2L2-01      GWSAFVCLYGNGAVGGARRFQEGYWSSMKTVVTG------AVALGAVMTV
H3AR18_MCL1-01        GWKGFVDFFHVEDA-------EGTIKNVLMTFAG------VAGLGASL--
                      **  :: :              .   .    ..*        .:   :  

H3ANS8_BCL2L1-01      --LFLRK
H3AR18_MCL1-02        --VYLMR
H3AAS7_BCL2L2-02      GALFASR
H3AAS7_BCL2L2-01      GALFASR
H3AR18_MCL1-01        --VYLMR
                        ::  .

© 1998-2019