Dataset for protein Bcl-w of organism Latimeria chalumnae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H3AAS7_BCL2L2-02      MDSLYSNRGVVEDFIYYKLGQKGYSQQGAPTDPPANPLYRAMREAGDEFE
H3AAS7_BCL2L2-01      MDSLYSNRGVVEDFIYYKLGQKGYSQQGAPTDPPANPLYRAMREAGDEFE
                      **************************************************

H3AAS7_BCL2L2-02      ARFHRTFNSLSSHLHITPGTAYRRFAETADSLFQDGVNWGRVVALFVFSA
H3AAS7_BCL2L2-01      ARFHRTFNSLSSHLHITPGTAYRRFAETADSLFQDGVNWGRVVALFVFSA
                      **************************************************

H3AAS7_BCL2L2-02      ALCVESVDKEMASLVGRIIDWTVTYVESSLQDWINHSGGWSAFVCLYGNG
H3AAS7_BCL2L2-01      ALCVESVDKEMASLVGRIIDWTVTYVESSLQDWINHSGGWSAFVCLYGNG
                      **************************************************

H3AAS7_BCL2L2-02      AVGGARRFQEGYWSSMKTVVTGAVALGAVMTVGALFASR
H3AAS7_BCL2L2-01      AVGGARRFQEGYWSSMKTVVTGAVALGAVMTVGALFASR
                      ***************************************

© 1998-2019