Dataset for protein BCL-2-like of organism Labrus bergylta

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3GP42_MCL1-01      MDIINMKRAAVSVSAGVMSFMMPQNGVGKGQMHYGPEASSPQIAMGSSLA
A0A3Q3EZU5_BCL2L10      -----------------------------------------------MCR
A0A3Q3EZU5_BCL2L10      -----------------------------------------------MCR
A0A3Q3G1D7_BCL2-01      ------------------MANECNRNIVEKYICHKLSKRGYEWGFEDEQD
A0A3Q3FUB6_BCL2L1-      -------------------MSYSNRELVEFFISYKLSQRNYPTYVLRSED
A0A3Q3G2E1_BCL2L1-      --------------------MSQNRELVVFYITYKFSQRNYPLNHMELLE
A0A3Q3G2E1_BCL2L1-      --------------------MSQNRELVVFYITYKFSQRNYPLNHMELLE
A0A3Q3G2E1_BCL2L1-      --------------------MSQNRELVVFYITYKFSQRNYPLNHMELLE
                                                                          

A0A3Q3GP42_MCL1-01      SQNGNVGSNETTKRPKALVVNSGN--DDIEDGSLPCTPEPDSETEVSSCP
A0A3Q3EZU5_BCL2L10      AQSDIAGRKMSCGLWKETLALAEDYLSLCCTSPRPAPP--------PP--
A0A3Q3EZU5_BCL2L10      AQSDIAGRKMSCGLWKETLALAEDYLSLCCTSPRPAPP--------PP--
A0A3Q3G1D7_BCL2-01      EDAANNGSLV--APPPTLVRRCREASSGPDRESIPHLCKRPPQSD-----
A0A3Q3FUB6_BCL2L1-      AGERTEGDMENSAASNGFLVNSR---NRAGQSVMSSSPH-----------
A0A3Q3G2E1_BCL2L1-      PPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPA--
A0A3Q3G2E1_BCL2L1-      PPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPA--
A0A3Q3G2E1_BCL2L1-      PPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPA--
                              *              .    .       .               

A0A3Q3GP42_MCL1-01      TGGEVLESDTRQLISAFLREHTGLSKPGWNESSALSTMKRVVEDVLAKHR
A0A3Q3EZU5_BCL2L10      -------------------------------SMSAAAIRRLAQDMEKQHQ
A0A3Q3EZU5_BCL2L10      -------------------------------SMSAAAIRRLAQDMEKQHQ
A0A3Q3G1D7_BCL2-01      --------------------------------PAYADIHRVLREAGDELE
A0A3Q3FUB6_BCL2L1-      --------------------------------TDIEAVKAALLDSADEFE
A0A3Q3G2E1_BCL2L1-      -------------------------------TTNLDAVKEALRDSANEFE
A0A3Q3G2E1_BCL2L1-      -------------------------------TTNLDAVKEALRDSANEFE
A0A3Q3G2E1_BCL2L1-      -------------------------------TTNLDAVKEALRDSANEFE
                                                             :.    :   :  

A0A3Q3GP42_MCL1-01      YAYNGMINKLSLEDRGDDAS---FVSAVAKSLFADGTTNWGRIASLVAFG
A0A3Q3EZU5_BCL2L10      ARFQSLAQTFLRQCGPDPCS---GLRKVMEELVGDGHLNWGRVVSLFTFT
A0A3Q3EZU5_BCL2L10      ARFQSLAQTFLRQCGPDPCS---GLRKVMEELVGDGHLNWGRVVSLFTFT
A0A3Q3G1D7_BCL2-01      RLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDG-VNWGRIIAFFEFG
A0A3Q3FUB6_BCL2L1-      LLFTQAFSDLSSQLDITPNTAYHSFKSVMDEVFKDG-VNWGRIVGLFAFG
A0A3Q3G2E1_BCL2L1-      LRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDG-VNWGRIVGLFAFG
A0A3Q3G2E1_BCL2L1-      LRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDG-VNWGRIVGLFAFG
A0A3Q3G2E1_BCL2L1-      LRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDG-VNWGRIVGLFAFG
                          :      :  :      :    .  * ..:. **  ****: .:. * 

A0A3Q3GP42_MCL1-01      AAVSQYLKEN-GRGHCVELV---------------GQEISTYLLSDHRDW
A0A3Q3EZU5_BCL2L10      GVLARQLQEQEDVKLGLDPVQGQKLGQGPGHCRGLAETIADYLGEEKKEW
A0A3Q3EZU5_BCL2L10      GVLARQLQEQEDVKLGLDPVQGQKLGQGPGHCRGLAETIADYLGEEKKEW
A0A3Q3G1D7_BCL2-01      GTVCVECMSKQEMTSQVDNI---------------AEWMTEYLNGPLNSW
A0A3Q3FUB6_BCL2L1-      GVLCVECVQK-DMGELVSRI---------------AGWMTTYLDEHISAW
A0A3Q3G2E1_BCL2L1-      GALCVECVEK-EMSPLVGRI---------------IEWMTVYLDNRIQPW
A0A3Q3G2E1_BCL2L1-      GALCVECVEK-EMSPLVGRI---------------IEWMTVYLDNRIQPW
A0A3Q3G2E1_BCL2L1-      GALCVECVEK-EMSPLVGRI---------------IEWMTVYLDNRIQPW
                        ..:.    .:      :  :                  :: **      *

A0A3Q3GP42_MCL1-01      LVKNNAWDGFVEFFRVADPESTVR-----TTLMAFAGFAGIGATLALLIR
A0A3Q3EZU5_BCL2L10      LLENDGWEGFCEF--SRSARETSQDSSMKTALFAAAGVGLAGLTF--LLV
A0A3Q3EZU5_BCL2L10      LLENDGWEGFCEF--SRSARETSQDSSMKTALFAAAGVGLAGLTF--LLI
A0A3Q3G1D7_BCL2-01      IQDNGGWDAFVELYDRQRDSAFCSSWPSIKTVFGLAALGAASLTIGAYLT
A0A3Q3FUB6_BCL2L1-      IESQGGWDCFVEIFGRGAVGEVRRSRETLTRWLLVGMALLMGVVVGVYIA
A0A3Q3G2E1_BCL2L1-      IESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIA
A0A3Q3G2E1_BCL2L1-      IESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIA
A0A3Q3G2E1_BCL2L1-      IESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIA
                        : .:..*: * *:                .  :  .     . ..   : 

A0A3Q3GP42_MCL1-01      ----
A0A3Q3EZU5_BCL2L10      R---
A0A3Q3EZU5_BCL2L10      RVQA
A0A3Q3G1D7_BCL2-01      QK--
A0A3Q3FUB6_BCL2L1-      KKH-
A0A3Q3G2E1_BCL2L1-      QKRL
A0A3Q3G2E1_BCL2L1-      QKRL
A0A3Q3G2E1_BCL2L1-      QKRL
                            

© 1998-2019