Dataset for protein Bcl2l10 of organism Labrus bergylta

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3EZU5_BCL2L10      MCRAQSDIAGRKMSCGLWKETLALAEDYLSLCCTSPRPAPPPPSMSAAAI
A0A3Q3EZU5_BCL2L10      MCRAQSDIAGRKMSCGLWKETLALAEDYLSLCCTSPRPAPPPPSMSAAAI
                        **************************************************

A0A3Q3EZU5_BCL2L10      RRLAQDMEKQHQARFQSLAQTFLRQCGPDPCSGLRKVMEELVGDGHLNWG
A0A3Q3EZU5_BCL2L10      RRLAQDMEKQHQARFQSLAQTFLRQCGPDPCSGLRKVMEELVGDGHLNWG
                        **************************************************

A0A3Q3EZU5_BCL2L10      RVVSLFTFTGVLARQLQEQEDVKLGLDPVQGQKLGQGPGHCRGLAETIAD
A0A3Q3EZU5_BCL2L10      RVVSLFTFTGVLARQLQEQEDVKLGLDPVQGQKLGQGPGHCRGLAETIAD
                        **************************************************

A0A3Q3EZU5_BCL2L10      YLGEEKKEWLLENDGWEGFCEFSRSARETSQDSSMKTALFAAAGVGLAGL
A0A3Q3EZU5_BCL2L10      YLGEEKKEWLLENDGWEGFCEFSRSARETSQDSSMKTALFAAAGVGLAGL
                        **************************************************

A0A3Q3EZU5_BCL2L10      TFLLVR---
A0A3Q3EZU5_BCL2L10      TFLLIRVQA
                        ****:*   

© 1998-2019