Dataset for protein Bcl-xL of organism Labrus bergylta

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3FUB6_BCL2L1-      MSYSNRELVEFFISYKLSQRNYPTYVLRSEDAGERTEGDMENSAASNGFL
A0A3Q3G2E1_BCL2L1-      -MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVA
A0A3Q3G2E1_BCL2L1-      -MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVA
A0A3Q3G2E1_BCL2L1-      -MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVA
                           .***** *:*:**:******   :   :. :**:*   .*. .: . 

A0A3Q3FUB6_BCL2L1-      VNSR---NRAGQSVMSSSPH----------TDIEAVKAALLDSADEFELL
A0A3Q3G2E1_BCL2L1-      THANGTFNGTSPGTPPASPHRQQQQRLPATTNLDAVKEALRDSANEFELR
A0A3Q3G2E1_BCL2L1-      THANGTFNGTSPGTPPASPHRQQQQRLPATTNLDAVKEALRDSANEFELR
A0A3Q3G2E1_BCL2L1-      THANGTFNGTSPGTPPASPHRQQQQRLPATTNLDAVKEALRDSANEFELR
                        .::.   * :. .. .:***          *:::*** ** ***:**** 

A0A3Q3FUB6_BCL2L1-      FTQAFSDLSSQLDITPNTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVL
A0A3Q3G2E1_BCL2L1-      YASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGAL
A0A3Q3G2E1_BCL2L1-      YASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGAL
A0A3Q3G2E1_BCL2L1-      YASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGAL
                        ::.***** .** *** *:::**:.******.****************.*

A0A3Q3FUB6_BCL2L1-      CVECVQKDMGELVSRIAGWMTTYLDEHISAWIESQGGWDCFVEIFGRGAV
A0A3Q3G2E1_BCL2L1-      CVECVEKEMSPLVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAA
A0A3Q3G2E1_BCL2L1-      CVECVEKEMSPLVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAA
A0A3Q3G2E1_BCL2L1-      CVECVEKEMSPLVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAA
                        *****:*:*. **.**  ***.***:.*..********: * ****..*.

A0A3Q3FUB6_BCL2L1-      GEVRRSRETLTRWLLVGMALLMGVVVGVYIAKKH-
A0A3Q3G2E1_BCL2L1-      GEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A3Q3G2E1_BCL2L1-      GEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A3Q3G2E1_BCL2L1-      GEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
                        **:***.*::..***.**:*: *****  **:*. 

© 1998-2019