Dataset for protein Mcl-1 of organism Kryptolebias marmoratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3B4V7_MCL1-01      MFPKPKPSYIFFLQNGVVDGLHRDTSPQVSIGASLGSENGSVASCNSSKR
A0A3Q3B4V7_MCL1-02      MFPKPKPSYIFFLQNGVVDGLHRDTSPQVSIGASLGSENGSVASCNSSKR
                        **************************************************

A0A3Q3B4V7_MCL1-01      PKDLVMPPLKGYQDKRFQELGDDHGSLPSTPEVDGNPDVPGGAEDEVLEN
A0A3Q3B4V7_MCL1-02      PKDLVMPPLKGYQDKRFQELGDDHGSLPSTPEVDGNPDVPGGAEDEVLEN
                        **************************************************

A0A3Q3B4V7_MCL1-01      DTKHLISRFLQEFTGLSKRQWSESKELSTMNRVVEDLLTKHRFAYNGIIK
A0A3Q3B4V7_MCL1-02      DTKHLISRFLQEFTGLSKRQWSESKELSTMNRVVEDLLTKHRFAYNGIIK
                        **************************************************

A0A3Q3B4V7_MCL1-01      KLSLDDKSEDMTFVTKTARSLFADGITNWGRISSLVAFGAVVAVHLKEKG
A0A3Q3B4V7_MCL1-02      KLSLDDKSEDMTFVTKTARSLFADGITNWGRISSLVAFGAVVAVHLKEKG
                        **************************************************

A0A3Q3B4V7_MCL1-01      REECVELVGQEISTYLLSEQKDWLLKNNSWSGFVEFFRITDPESTVRNTL
A0A3Q3B4V7_MCL1-02      REECVELVGQEISTYLLSEQKDWLLKNNSWSGFVEFFRITDPESTVRNTL
                        **************************************************

A0A3Q3B4V7_MCL1-01      MAVAGFAGLGATLALLISV-------------------------------
A0A3Q3B4V7_MCL1-02      MAVAGFAGLGATLALLISTWSAKCEHRPLENESCVSLAPGIRSCYLSTTT
                        ******************.                               

A0A3Q3B4V7_MCL1-01      --------------------------------CWP-------------
A0A3Q3B4V7_MCL1-02      HLSWAAEIWAAGVDQQDESNLNIGWILPLHNDCWRQAPAPCVSAGKRE
                                                        **              

© 1998-2019