Dataset for protein BCL-2-like of organism Kryptolebias marmoratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3B0R2_BCL2-01      -----MEVNRFIVENYICHKLSKR-------GYAWGSDRPRRVRDDAANN
A0A3Q3B4V7_MCL1-01      MFPKPKPSYIFFLQNGVVDGLHRDTSPQVSIGASLGSENGSVASCNSSKR
A0A3Q3B4V7_MCL1-02      MFPKPKPSYIFFLQNGVVDGLHRDTSPQVSIGASLGSENGSVASCNSSKR
A0A3Q3B3X5_BCL2L1-      -MSQNKELVLFYIMYKLSQR----------------------------NY
A0A3Q3BEB7_BCL2L1-      MSHSNRDLVQFYISYKLSQR----------------------------NC
                                  * :   :                               : 

A0A3Q3B0R2_BCL2-01      GSVASQSPTLVRRCRGARGAPGGAGTAPPDAESDPDPVLCG---------
A0A3Q3B4V7_MCL1-01      PKDLVMPPLKGYQDKRFQELGDDHGSLPSTPEVDGNPDVPGGAEDEVLEN
A0A3Q3B4V7_MCL1-02      PKDLVMPPLKGYQDKRFQELGDDHGSLPSTPEVDGNPDVPGGAEDEVLEN
A0A3Q3B3X5_BCL2L1-      PVNHIILSDPPNRTDAGDAGLEDAEMTETHANGTFNGTSPG---------
A0A3Q3BEB7_BCL2L1-      SKSLLMPEVAGERTEKASSAPSNGLLVNSRDGQS----------------
                                    .         .     .                     

A0A3Q3B0R2_BCL2-01      -------------------RISPHEPLAHIHRVLREAGDELERLYQPDFV
A0A3Q3B4V7_MCL1-01      DTKHLISRFLQEFTGLSKRQWSESKELSTMNRVV----EDLLTKHRFAYN
A0A3Q3B4V7_MCL1-02      DTKHLISRFLQEFTGLSKRQWSESKELSTMNRVV----EDLLTKHRFAYN
A0A3Q3B3X5_BCL2L1-      ---------TPPASPLRQQPLPTTANMDKVKEALRDTANEFELRYARAFS
A0A3Q3BEB7_BCL2L1-      ----------------GKKIWPRRSDIEAVKSALKDSADEFERLYTQSFS
                                             .    :  :: .:    :::   :   : 

A0A3Q3B0R2_BCL2-01      EMSRQLGLASAAAKARF-AEVMDELFRDGV-NWGRIIAFFEFGGTVCVEC
A0A3Q3B4V7_MCL1-01      GIIKKLSLDDKSEDMTFVTKTARSLFADGITNWGRISSLVAFGAVVAVHL
A0A3Q3B4V7_MCL1-02      GIIKKLSLDDKSEDMTFVTKTARSLFADGITNWGRISSLVAFGAVVAVHL
A0A3Q3B3X5_BCL2L1-      DLHSQLHITPGTVYQSF-ENVMDEVFRDGV-NWGRIVGLFAFGGALCVEC
A0A3Q3BEB7_BCL2L1-      HLSLQLDISPDTVYHSF-KSVLDELFKDGV-NWGRVVGLFAFGGVLCVQC
                         :  :* :   :    *  ..  .:* **: ****: .:. **..:.*  

A0A3Q3B0R2_BCL2-01      ASREEMTPQVDHIAEWMTEYLNGPLNSWIEDNGGWDAFVELYDRHKESVF
A0A3Q3B4V7_MCL1-01      KEKGR-EECVELVGQEISTYLLSEQKDWLLKNNSWSGFVEFFRITDPE--
A0A3Q3B4V7_MCL1-02      KEKGR-EECVELVGQEISTYLLSEQKDWLLKNNSWSGFVEFFRITDPE--
A0A3Q3B3X5_BCL2L1-      VEKEM-SHLVARIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGDNAAAES
A0A3Q3BEB7_BCL2L1-      VERDM-SELVSRIADWMTVYLDEQIGPWIDSQGGWDSFAEMYGRDAAAEA
                         ..      *  : : :: **      *: .:..*. *.*::        

A0A3Q3B0R2_BCL2-01      SCYWPSIKTVFGLAALGAASITIGAYLTQKMPLTP---------------
A0A3Q3B4V7_MCL1-01      STVRNTLMAVAGFAGLGATLALLISV------------------------
A0A3Q3B4V7_MCL1-02      STVRNTLMAVAGFAGLGATLALLISTWSAKCEHRPLENESCVSLAPGIRS
A0A3Q3B3X5_BCL2L1-      RISQEGLKKWL-LVGMTVVTAVVAGSLFAQKRL-----------------
A0A3Q3BEB7_BCL2L1-      RRFQESLKKWL-LAGAALLAGLLLGVLVAKKR------------------
                           .  :     :..       : .                         

A0A3Q3B0R2_BCL2-01      ---------------------QRQPSDQIWLSSKPRSENCFPPPAPPCQN
A0A3Q3B4V7_MCL1-01      ---------------------------------------CWP--------
A0A3Q3B4V7_MCL1-02      CYLSTTTHLSWAAEIWAAGVDQQDESNLNIGWILPLHNDCWRQAPAPCVS
A0A3Q3B3X5_BCL2L1-      --------------------------------------------------
A0A3Q3BEB7_BCL2L1-      --------------------------------------------------
                                                                          

A0A3Q3B0R2_BCL2-01      RHKSKQQREPEARPREQRMSEVESH
A0A3Q3B4V7_MCL1-01      -------------------------
A0A3Q3B4V7_MCL1-02      AGKRE--------------------
A0A3Q3B3X5_BCL2L1-      -------------------------
A0A3Q3BEB7_BCL2L1-      -------------------------
                                                 

© 1998-2019