Dataset for protein Bcl-xL of organism Kryptolebias marmoratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3B3X5_BCL2L1-      -MSQNKELVLFYIMYKLSQRNYPVNHIILSDPPNRTDAGDAGLEDAEMTE
A0A3Q3BEB7_BCL2L1-      MSHSNRDLVQFYISYKLSQRNCSKSLLMPEVAGERTEKASSAPSNGLLVN
                           .*.:** *** ******* . . :: . . :**: ..:. .:. :.:

A0A3Q3B3X5_BCL2L1-      THANGTFNGTSPGTPPASPLRQQPLPTTANMDKVKEALRDTANEFELRYA
A0A3Q3BEB7_BCL2L1-      SRDGQS--------------GKKIWPRRSDIEAVKSALKDSADEFERLYT
                        :. . :               ::  *  :::: **.**.*:*:***  *:

A0A3Q3B3X5_BCL2L1-      RAFSDLHSQLHITPGTVYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCV
A0A3Q3BEB7_BCL2L1-      QSFSHLSLQLDISPDTVYHSFKSVLDELFKDGVNWGRVVGLFAFGGVLCV
                        .:** *  ** *:*.***:**:.*:**:*.*******:********.***

A0A3Q3B3X5_BCL2L1-      ECVEKEMSHLVARIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGDNAAAE
A0A3Q3BEB7_BCL2L1-      QCVERDMSELVSRIADWMTVYLDEQIGPWIDSQGGWDSFAEMYGRDAAAE
                        :***.:** **:**.:*******::* ***:*****: ***::* :****

A0A3Q3B3X5_BCL2L1-      SRISQEGLKKWLLVGMTVVTAVVAGSLFAQKRL
A0A3Q3BEB7_BCL2L1-      ARRFQESLKKWLLAGAALLAGLLLGVLVAKKR-
                        :*  **.******.* ::::.:: * *.*:** 

© 1998-2019