Dataset for protein BCL-2-like of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287DCH9_MCL1-02      MFGLKRNAVIGLNLYCG---------------------------------
A0A287DCH9_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGASGGATPPGAQLLAAEKEAAARREAGGG
A0A287CZ07_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
I3MCZ7_BCL2A1-01        --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
I3ND50_BCL2L2-02        --------------------------------------------------
I3ND50_BCL2L2-01        --------------------------------------------------
                                                                          

A0A287DCH9_MCL1-02      -----------------GAEVPDVTATPARRLFFAPTYCVSPPEKMEAPA
A0A287DCH9_MCL1-01      EAAQPPSARRVARPVPIGAEVPDVTATPARRLFFAPTYCVSPPEKMEAPA
A0A287CZ07_BCL2L1-      --------------------------------------------------
I3MUP5_BCL2L1-03        --------------------------------------------------
I3MUP5_BCL2L1-01        --------------------------------------------------
I3MUP5_BCL2L1-02        --------------------------------------------------
I3MCZ7_BCL2A1-01        ----------------------------------------------MNDC
I3MVK9_BCL2-01          --------------------------------------------MAHAGR
I3ND50_BCL2L2-02        ---------------------------------------------MATPA
I3ND50_BCL2L2-01        ---------------------------------------------MATPA
                                                                          

A0A287DCH9_MCL1-02      AAMSPEEELDGYEPEPLGKRPAVLPLLELVGEAAKSPGADGSLPSTPPPA
A0A287DCH9_MCL1-01      AAMSPEEELDGYEPEPLGKRPAVLPLLELVGEAAKSPGADGSLPSTPPPA
A0A287CZ07_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSA
I3MUP5_BCL2L1-03        MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSA
I3MUP5_BCL2L1-01        MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSA
I3MUP5_BCL2L1-02        MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSA
I3MCZ7_BCL2A1-01        EFRFIHTLAQDYLQHVLQ--------------------------------
I3MVK9_BCL2-01          TGYDNREIVMKYIHYKLSQRGYEWDAGDVGAASPGAAPGPGIFSSQPGSH
I3ND50_BCL2L2-02        SAPDTRALVADFVGYKLRQKGY----------------------------
I3ND50_BCL2L2-01        SAPDTRALVADFVGYKLRQKGY----------------------------
                                   :    *                                 

A0A287DCH9_MCL1-02      EEEDDELYRQSLEIISRYLREQATGSKDAKPLRGSGAASRKALETLRRVG
A0A287DCH9_MCL1-01      EEEDDELYRQSLEIISRYLREQATGSKDAKPLRGSGAASRKALETLRRVG
A0A287CZ07_BCL2L1-      INGNPSWHLADSPAIN------GATGHSSSLDAREVIPMAAVKQALREAG
I3MUP5_BCL2L1-03        INGNPSWHLADSPAVN------GATGHSSSLDAREVIPMAAVKQALREAG
I3MUP5_BCL2L1-01        INGNPSWHLADSPAVN------GATGHSSSLDAREVIPMAAVKQALREAG
I3MUP5_BCL2L1-02        INGNPSWHLADSPAVN------GATGHSSSLDAREVIPMAAVKQALREAG
I3MCZ7_BCL2A1-01        ---------------V------PQRGSSPSKTSK------VLQNVAFSVQ
I3MVK9_BCL2-01          TPAARTSPPPPPAAPA------AAAGPVLSPVPP------VVHLTLRQAG
I3ND50_BCL2L2-02        ---------------V------CGAGPGEGPAAD------PLHQAMRAAG
I3ND50_BCL2L2-01        ---------------V------CGAGPGEGPAAD------PLHQAMRAAG
                                                 .                  .   . 

A0A287DCH9_MCL1-02      DGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTL
A0A287DCH9_MCL1-01      DGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTL
A0A287CZ07_BCL2L1-      DEFELWYWRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGV-NWGHIVAF
I3MUP5_BCL2L1-03        DEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV-NWGRIVAF
I3MUP5_BCL2L1-01        DEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV-NWGRIVAF
I3MUP5_BCL2L1-02        DEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV-NWGRIVAF
I3MCZ7_BCL2A1-01        KEVEKNLKPFLDNFDV---VSADTARTIFNQVMEKEFEDGIMNWGRIVTI
I3MVK9_BCL2-01          DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGV-NWGRIVAF
I3ND50_BCL2L2-02        DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP-NWGRLVAF
I3ND50_BCL2L2-01        DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP-NWGRLVAF
                        . .. .    :  :     :.       :  *    * .*  ***.:*::

A0A287DCH9_MCL1-02      ISFGAFVAKHLKSINQESCIE---PLAESITDVLVRTKRDWLVKQRGWDG
A0A287DCH9_MCL1-01      ISFGAFVAKHLKSINQESCIE---PLAESITDVLVRTKRDWLVKQRGWDG
A0A287CZ07_BCL2L1-      LSFGGALCMESVDKEMQVLVS---RIASWM---------PWIQENGGWDT
I3MUP5_BCL2L1-03        FSFGGALCVESVDKEMQVLVS---RIASWMATYLNDHLEPWIQENGGWDT
I3MUP5_BCL2L1-01        FSFGGALCVESVDKEMQVLVS---RIASWMATYLNDHLEPWIQENGGWDT
I3MUP5_BCL2L1-02        FSFGGALCVESVDKEMQVLVS---RIASWMATYLNDHLEPWIQENGGWDT
I3MCZ7_BCL2A1-01        FAFGGVLVKKLLRERIAPAVDSDEEISYFVAEFIMNNAGEWIRQNGGW--
I3MVK9_BCL2-01          FEFGGVMCVESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW--
I3ND50_BCL2L2-02        FVFGAALCAESVNKEMEPLVG---QVQEWMVAYLETRLADWIHSSGGW--
I3ND50_BCL2L2-01        FVFGAALCAESVNKEMEPLVG---QVQEWMVAYLETRLADWIHSSGGWAE
                        : **. :            :     :   :          *: .. **  

A0A287DCH9_MCL1-02      FVEFFHVEDLE---------GGIRNVLLAFAGVAGVGAGLAYLIR-----
A0A287DCH9_MCL1-01      FVEFFHVEDLE---------GGIRNVLLAFAGVAGVGAGLAYLIR-----
A0A287CZ07_BCL2L1-      FVELYRNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK-------
I3MUP5_BCL2L1-03        FVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK-------
I3MUP5_BCL2L1-01        FVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK-------
I3MUP5_BCL2L1-02        FVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK-------
I3MCZ7_BCL2A1-01        -----------------E--NGFVKKFEPKSGWLTFLGVTGQICEMLSLL
I3MVK9_BCL2-01          ------------------------------VGARRVE-------------
I3ND50_BCL2L2-02        ---LFSRGNMGALI------GGWDSC----AGKEAWG-------------
I3ND50_BCL2L2-01        FTALYGDGALEEARRLRE--GNWASVRTVLTGAVALGALVTVGAFFASK-
                                                       *                  

A0A287DCH9_MCL1-02      ----
A0A287DCH9_MCL1-01      ----
A0A287CZ07_BCL2L1-      ----
I3MUP5_BCL2L1-03        ----
I3MUP5_BCL2L1-01        ----
I3MUP5_BCL2L1-02        ----
I3MCZ7_BCL2A1-01        KQYY
I3MVK9_BCL2-01          ----
I3ND50_BCL2L2-02        ----
I3ND50_BCL2L2-01        ----
                            

© 1998-2019